BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0894 (696 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC032326-1|AAH32326.1| 188|Homo sapiens C12orf45 protein protein. 30 9.1 >BC032326-1|AAH32326.1| 188|Homo sapiens C12orf45 protein protein. Length = 188 Score = 29.9 bits (64), Expect = 9.1 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +2 Query: 44 PDGKSSELGFTNDELQDCSDSEKDLRAITPLDKNKNNSENEIHDDEIQSEV 196 P K ++ E+ E D + D ++N+SE+E DD I SEV Sbjct: 106 PHSKVIQMDVALFEMNQSDSKEVDSSEESSQDSSENSSESEDEDDSIPSEV 156 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,857,352 Number of Sequences: 237096 Number of extensions: 1331636 Number of successful extensions: 7446 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 7223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7446 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -