BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0894 (696 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16640.1 68416.m02127 translationally controlled tumor family... 35 0.059 At5g54790.1 68418.m06825 hypothetical protein 34 0.078 At4g34680.1 68417.m04923 GATA transcription factor 3, putative (... 31 0.55 At3g05540.1 68416.m00607 translationally controlled tumor family... 30 1.3 At3g54170.1 68416.m05988 FKBP12 interacting protein (FIP37) iden... 30 1.7 At2g42380.2 68415.m05245 bZIP transcription factor family protein 30 1.7 At2g42380.1 68415.m05244 bZIP transcription factor family protein 30 1.7 At5g25820.1 68418.m03064 exostosin family protein contains Pfam ... 29 3.9 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 28 5.1 At1g74690.1 68414.m08650 calmodulin-binding family protein low s... 28 5.1 At4g21440.1 68417.m03099 myb family transcription factor (MYB102... 28 6.8 At3g54700.1 68416.m06052 phosphate transporter, putative strong ... 28 6.8 At5g05700.1 68418.m00627 arginine-tRNA-protein transferase 1 / a... 27 9.0 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 27 9.0 At2g27170.1 68415.m06029 structural maintenance of chromosomes (... 27 9.0 At1g61390.1 68414.m06918 S-locus protein kinase, putative contai... 27 9.0 At1g55600.1 68414.m06364 WRKY family transcription factor simila... 27 9.0 At1g35610.1 68414.m04421 DC1 domain-containing protein contains ... 27 9.0 >At3g16640.1 68416.m02127 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 168 Score = 34.7 bits (76), Expect = 0.059 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +2 Query: 434 NPNPEETSETKSVEDFNVAANAMVETEAITPEPTYDKENVVADI 565 NP+ EE E + V+D +V+T + +PTYDK+ +A I Sbjct: 48 NPSAEEGGEDEGVDDSTQKVVDIVDTFRLQEQPTYDKKGFIAYI 91 >At5g54790.1 68418.m06825 hypothetical protein Length = 119 Score = 34.3 bits (75), Expect = 0.078 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%) Frame = +2 Query: 431 NNPNPEETSETKSVEDFNVAANAMVETEAITPEPTYDKENVVADIHT-EEPQDIFPEISS 607 ++ NPEE+S T EDF A++++V+ + D + VA T + + Sbjct: 21 DDQNPEESSWTMYFEDFFEASSSIVDVGDFSSSSVSDAASFVATKKTLNVSKQEGSNLDI 80 Query: 608 KHTMPPEIRLYGQEFTLSENADSPVPSP 691 K T EI +G+ L + A SP SP Sbjct: 81 KRTRNREIP-FGRHHDLEDTASSPSGSP 107 >At4g34680.1 68417.m04923 GATA transcription factor 3, putative (GATA-3) identical to GATA-binding transcription factor GATA-3 [Arabidopsis thaliana] gi|2959734|emb|CAA74001; identical to cDNA for GATA transcription factor 3 GI:2959733 Length = 269 Score = 31.5 bits (68), Expect = 0.55 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 8 SHKLMFEQIPEIPDGKSSELGFTNDELQDCSDSEKDLRAITPLDKNK 148 S +F+Q+P +PD EL + + + DCS E L +T K K Sbjct: 82 SQPCIFDQLPSLPDEDVEELEWVSRVVDDCSSPEVSL-LLTQTHKTK 127 >At3g05540.1 68416.m00607 translationally controlled tumor family protein similar to translationally controlled tumor protein GB:AAD10032 from [Hevea brasiliensis] Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +2 Query: 434 NPNPEETSETKSVEDFNVAANAMVETEAITPEPTYDKENVV 556 NP+ EE E + V+D V +++T + +P++DK+ V Sbjct: 35 NPSGEEGGEDEGVDDQAVKVVDIIDTFRLQEQPSFDKKQFV 75 >At3g54170.1 68416.m05988 FKBP12 interacting protein (FIP37) identical to FKBP12 interacting protein (FIP37) GI:3859944 from [Arabidopsis thaliana] Length = 330 Score = 29.9 bits (64), Expect = 1.7 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +2 Query: 14 KLMFEQIPEIPDGKSSELGFTNDELQDCSDSEKDLRAITPLDKNKNNS 157 K F+ +P GKS E F D +Q+ SEK L+ + K K S Sbjct: 86 KSAFQNESFVPAGKSPEPRFLIDYIQNLKSSEKSLKEQLEIAKRKEAS 133 >At2g42380.2 68415.m05245 bZIP transcription factor family protein Length = 321 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +2 Query: 44 PDGKSSELGFTNDELQDCSDSEKDLRAITPLDKNKNNSENEIHDDEIQSE 193 P G SS ++ D D + + P D N NN+ N ++DE+QS+ Sbjct: 118 PTGSSSNTSTPSNSFND------DNKELPPSDHNMNNNINNNYNDEVQSQ 161 >At2g42380.1 68415.m05244 bZIP transcription factor family protein Length = 310 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +2 Query: 44 PDGKSSELGFTNDELQDCSDSEKDLRAITPLDKNKNNSENEIHDDEIQSE 193 P G SS ++ D D + + P D N NN+ N ++DE+QS+ Sbjct: 118 PTGSSSNTSTPSNSFND------DNKELPPSDHNMNNNINNNYNDEVQSQ 161 >At5g25820.1 68418.m03064 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 654 Score = 28.7 bits (61), Expect = 3.9 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = +2 Query: 509 TEAITPEPTYDKENVVAD-IHTEEPQDIFPEIS-SKHTMPPEIRLYGQEFTL-SENADSP 679 T AI P P D+E V D I+ P IS + T+PP + + + T + NA +P Sbjct: 62 TSAIAPSPAGDEEEVEVDQIYDSSGNATAPAISPTTATLPPLLPILKENATAPTANAKAP 121 Query: 680 VPSP 691 +P Sbjct: 122 GLNP 125 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +2 Query: 20 MFEQIPEIPDGKSSELGFTNDELQDCSDSEK-DLRAITPL-DKNKNNSENEIHDDEIQSE 193 +FE +P + D SELG + + + EK D + L +++ + E+E D+E + E Sbjct: 139 LFEGLPSVLDSMGSELGDSRKKRKKKRSEEKQDHEDVDELANEDLEHEESEFSDEESEEE 198 >At1g74690.1 68414.m08650 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 587 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/67 (22%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +2 Query: 437 PNPEETSETKSVEDFNVAANAMVETEAI--TPEPTYDKENVVADIHTEEPQDIFPEISSK 610 P P++T K V A + +++ P ++ +V E+P+ F ++SS+ Sbjct: 259 PQPKKTISRKPQNRLLVEAESAKPKKSVRKVPASNFESSSVQTSFEFEKPKRSFRKVSSQ 318 Query: 611 HTMPPEI 631 PP + Sbjct: 319 SIEPPAV 325 >At4g21440.1 68417.m03099 myb family transcription factor (MYB102) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 350 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 135 NGVIALKSFSLSEQSCNSSFVNPNSELFPSGISGICSNINLWD 7 N V+ S S S + NSS++N +S I CSN+ +D Sbjct: 296 NSVLNTPSSSPSPTTLNSSYINSSSCSTEDEIESYCSNLMKFD 338 >At3g54700.1 68416.m06052 phosphate transporter, putative strong similarity to phosphate transporter (AtPT2) [Arabidopsis thaliana] GI:1502430 Length = 433 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 408 SNTFSLFSKEFSMSDSTFLY--SSTWYL 331 SN+F LFSKEF L +STW+L Sbjct: 174 SNSFGLFSKEFMKRHGLHLLGTTSTWFL 201 >At5g05700.1 68418.m00627 arginine-tRNA-protein transferase 1 / arginyltransferase 1 / arginyl-tRNA-protein transferase 1 (ATE1) identical to SP|Q9ZT48 Arginine-tRNA-protein transferase 1 (EC 2.3.2.8) (R-transferase 1) (Arginyltransferase 1) (Arginyl-tRNA--protein transferase 1) {Arabidopsis thaliana} Length = 632 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +2 Query: 35 PEIPDGKSSELGFTNDELQDCSDSEKDLRAITPLDKNKNNS--ENEIHDDEIQSE 193 P + + E G TND CSD ++D D + + E E D I+S+ Sbjct: 517 PAASEHEDMEQGETNDNFMGCSDEDEDEDEDDDDDDDDDEEMYETESEDSHIESD 571 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 114 SFSLSEQSCNSSFVNPNSELFPSGISGICSNINLWDS 4 SF Q C SS +P+S+LF G+S +L D+ Sbjct: 24 SFHFLPQFCTSSSASPSSKLFIGGLSWSVDEQSLKDA 60 >At2g27170.1 68415.m06029 structural maintenance of chromosomes (SMC) family protein similar to basement membrane-associated chondroitin proteoglycan Bamacan [Rattus norvegicus] GI:1785540; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain. No suitalble start codon was identified. Length = 1207 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/38 (26%), Positives = 23/38 (60%) Frame = +2 Query: 71 FTNDELQDCSDSEKDLRAITPLDKNKNNSENEIHDDEI 184 + ++ L++ + +++LR LDK + + E I+D E+ Sbjct: 195 YLDERLRELDEEKEELRKYQQLDKQRKSLEYTIYDKEL 232 >At1g61390.1 68414.m06918 S-locus protein kinase, putative contains protein kinase domain, Pfam:PF00069; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 831 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -1 Query: 681 TGESAFSLKVNSCPYNLI-SGGIVCLDEISGKISWGS 574 TGE+ S N C L+ +G +V +D++SGK W S Sbjct: 128 TGEAFTS---NKCHAELLDTGNLVVIDDVSGKTLWKS 161 >At1g55600.1 68414.m06364 WRKY family transcription factor similar to SPF1 protein GI:484261 from [Ipomoea batatas]; contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 485 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = +2 Query: 254 IIQDSSVDILQALRS-SEVG--DEKDEDFRYQVEEYKKVESD 370 ++ D+ DI+ S SE G D+ DEDF+Y+ E+ + + D Sbjct: 206 LVDDAHTDIISIEDSESEDGNKDDDDEDFQYEDEDEDQYDQD 247 >At1g35610.1 68414.m04421 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 612 Score = 27.5 bits (58), Expect = 9.0 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 4/61 (6%) Frame = -3 Query: 670 CIFT*SKFLPIQSNFRGHC----VFR*NFRENILGFFSVNICNNVFFVIGWFRCNGFSFN 503 CIF S F+ S FR + VFR N L + N C + F G+ R + +N Sbjct: 522 CIFGSSVFMKPGSIFRDYYGKVQVFRNNSNTRQLCYMCHNRCTGLIFYEGYRRNATYYYN 581 Query: 502 H 500 H Sbjct: 582 H 582 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,626,359 Number of Sequences: 28952 Number of extensions: 202124 Number of successful extensions: 833 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -