SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0892
         (637 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    22   4.3  
AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    22   5.7  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    22   5.7  

>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 22.2 bits (45), Expect = 4.3
 Identities = 15/50 (30%), Positives = 19/50 (38%)
 Frame = +2

Query: 476 KKDRCSQKETMRRY*QDFRRYQPKRNRPLVTGCFCQRRYYWTTQSKKAQY 625
           +K R + KE  R   +  R  +PK    L   C     YY     KK  Y
Sbjct: 279 RKYRETSKERSRDRRERERSKEPKIISSLSNSCNYSNNYYNNNNYKKLYY 328


>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 140 GPPKPCRCAN*CL 178
           G P+PCRC   C+
Sbjct: 474 GLPEPCRCHARCI 486


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +2

Query: 140 GPPKPCRCAN*CL 178
           G P+PCRC   C+
Sbjct: 474 GLPEPCRCHARCI 486


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 161,154
Number of Sequences: 438
Number of extensions: 3051
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19071468
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -