BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0892 (637 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 4.3 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.7 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.7 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 4.3 Identities = 15/50 (30%), Positives = 19/50 (38%) Frame = +2 Query: 476 KKDRCSQKETMRRY*QDFRRYQPKRNRPLVTGCFCQRRYYWTTQSKKAQY 625 +K R + KE R + R +PK L C YY KK Y Sbjct: 279 RKYRETSKERSRDRRERERSKEPKIISSLSNSCNYSNNYYNNNNYKKLYY 328 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 140 GPPKPCRCAN*CL 178 G P+PCRC C+ Sbjct: 474 GLPEPCRCHARCI 486 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 140 GPPKPCRCAN*CL 178 G P+PCRC C+ Sbjct: 474 GLPEPCRCHARCI 486 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,154 Number of Sequences: 438 Number of extensions: 3051 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -