BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0891 (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16340.1 68416.m02066 ABC transporter family protein similar ... 34 0.071 At1g45191.2 68414.m05184 glycosyl hydrolase family 1 protein Sin... 30 1.2 At4g22100.1 68417.m03195 glycosyl hydrolase family 1 protein con... 29 2.0 At4g10390.1 68417.m01705 protein kinase family protein contains ... 29 2.0 At2g39580.1 68415.m04855 expressed protein 29 2.0 At2g22795.1 68415.m02704 expressed protein 29 2.7 At1g77410.1 68414.m09015 beta-galactosidase, putative / lactase,... 29 2.7 At1g65340.1 68414.m07409 cytochrome P450, putative similar to cy... 29 2.7 At5g36230.1 68418.m04371 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 29 3.5 At4g37460.1 68417.m05302 tetratricopeptide repeat (TPR)-containi... 29 3.5 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 29 3.5 At4g16280.1 68417.m02469 flowering time control protein / FCA ga... 29 3.5 At3g11720.1 68416.m01437 expressed protein 29 3.5 At1g65220.1 68414.m07394 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 28 4.7 At5g49840.1 68418.m06172 ATP-dependent Clp protease ATP-binding ... 28 6.1 At5g58410.1 68418.m07314 expressed protein contains similarity t... 27 8.1 At5g50260.1 68418.m06224 cysteine proteinase, putative similar t... 27 8.1 At4g19490.2 68417.m02867 expressed protein 27 8.1 At4g19490.1 68417.m02866 expressed protein 27 8.1 At3g58260.1 68416.m06495 meprin and TRAF homology domain-contain... 27 8.1 At3g28720.1 68416.m03586 expressed protein 27 8.1 At1g60090.1 68414.m06770 glycosyl hydrolase family 1 protein con... 27 8.1 At1g47610.1 68414.m05288 transducin family protein / WD-40 repea... 27 8.1 >At3g16340.1 68416.m02066 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza]; contains Pfam profile: PF00005 ABC transporter Length = 1416 Score = 34.3 bits (75), Expect = 0.071 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 346 KWMKQAKVIDGKKITTTDTAIHFKKLKSVKLGIDDYQKFLDDLAKNKKVELDEIKKK 516 KW K+ ++ TT H + KLG+DD QKF+D + K + + ++ KK Sbjct: 41 KWAALEKLPTFARLRTTIIHPHEDLVDVTKLGVDDRQKFIDSIFKVTEEDNEKFLKK 97 >At1g45191.2 68414.m05184 glycosyl hydrolase family 1 protein Since this genomic sequence region is unfinished, the annotated gene may be missing a stop codon or start codon Length = 487 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 373 DGKKITTTDTAIHFKKLKSVKLGIDDYQKFLDDL 474 DG+K + DT +H +K+ + + D Y K+ +D+ Sbjct: 56 DGRKPSVWDTFLHCRKMDNGDIACDGYHKYKEDV 89 >At4g22100.1 68417.m03195 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; similar to hydroxyisourate hydrolase (GI:19569603) [Glycine max]; furostanol glycoside 26-O-beta-glucosidase F26G,Costus speciosus, PATCHX:S78099 Length = 507 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 373 DGKKITTTDTAIHFKKLKSVKLGIDDYQKFLDDLAKNKKVELDEIK 510 DG+K + DT +H + L + + D Y K+ +D+ + LD + Sbjct: 49 DGRKPSVWDTFLHTRNLSNGDITSDGYHKYKEDVKLMVETGLDAFR 94 >At4g10390.1 68417.m01705 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 342 Score = 29.5 bits (63), Expect = 2.0 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +1 Query: 427 SVKLGIDDYQKFLDDLAKNKKVELDEIKKKLTTCGQPGITSHVTKSPAAAAAVDRL 594 SV + D ++FLD +++DE+K L+ I+S ++ P+AA D L Sbjct: 272 SVDISEDKVRQFLDPRLLRDSLDIDEVKTMLSVAA-VCISSKLSLRPSAAQVADTL 326 >At2g39580.1 68415.m04855 expressed protein Length = 1567 Score = 29.5 bits (63), Expect = 2.0 Identities = 18/62 (29%), Positives = 33/62 (53%) Frame = +1 Query: 10 TAGSISAATKSASLKRLSATDSLAYMISSHKYIKHL*RKMSTEAQNTDAAVEQVTQEVKD 189 T ++S +T S + + S A + S+KYI R +S +AQ + VE + +++D Sbjct: 157 TKKALSTSTFSHAATSKVSNLSFAKEMKSNKYIHSSERTVSKDAQRPEQIVESNSNKLQD 216 Query: 190 VK 195 +K Sbjct: 217 LK 218 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 133 TEAQNTDAAVEQVTQEVKDVKLENGNAPGASNGTSSKS 246 T+ Q+ ++ + QEVKDV+ + P + NG S++S Sbjct: 693 TQEQSDSSSDTNLPQEVKDVRTDLETLPDSGNGGSNES 730 >At1g77410.1 68414.m09015 beta-galactosidase, putative / lactase, putative similar to beta-galactosidase SP:P45582 from [Asparagus officinalis] Length = 815 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 92 HHTNTLNTYKEKCLLKHRIRMPLWSK 169 H N+L ++ CL K R +P+WSK Sbjct: 769 HSPNSLAVVQKACLKKSRCSVPVWSK 794 >At1g65340.1 68414.m07409 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 503 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Frame = +1 Query: 499 DEIKKKLTTCGQPGITSHVTKSPAAAAAVDRLT-----DTSKY 612 D++ +K+ T + I SH T P+ A+D LT DT+KY Sbjct: 250 DQLLEKIITAKREEINSHGTHHPSRGEAIDVLTYYMTMDTTKY 292 >At5g36230.1 68418.m04371 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein low similarity to SP|Q13144 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Homo sapiens}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 411 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 133 TEAQNTDAAVEQVTQEVKDVKL 198 TE N D +E V Q++KD KL Sbjct: 265 TEESNVDEVIESVKQQIKDAKL 286 >At4g37460.1 68417.m05302 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 883 Score = 28.7 bits (61), Expect = 3.5 Identities = 20/77 (25%), Positives = 37/77 (48%) Frame = +1 Query: 16 GSISAATKSASLKRLSATDSLAYMISSHKYIKHL*RKMSTEAQNTDAAVEQVTQEVKDVK 195 G SA ++A +K+L + L + + + I + + +TE+ A + K K Sbjct: 99 GYKSALQQTADVKQLLELEEL--LKDARREIDGILKSHATESPQETPAYHSEKSDEKSDK 156 Query: 196 LENGNAPGASNGTSSKS 246 L+N + +SNG S +S Sbjct: 157 LDNHESGASSNGNSHES 173 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 142 QNTDAAVEQVTQEVKDVKLENGNAPGASNGTSSKSE 249 Q++ A+ Q+ Q+V+ ++ N N P + NG + K + Sbjct: 523 QSSQQAISQLQQQVQSMQQPNQNLPLSQNGRAGKQQ 558 >At4g16280.1 68417.m02469 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 505 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 142 QNTDAAVEQVTQEVKDVKLENGNAPGASNGTSSKSE 249 Q++ A+ Q+ Q+V+ ++ N N P + NG + K + Sbjct: 281 QSSQQAISQLQQQVQSMQQPNQNLPLSQNGRAGKQQ 316 >At3g11720.1 68416.m01437 expressed protein Length = 542 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +1 Query: 160 VEQVTQE--VKDVKLENGNAPGASNGTSSKSED 252 V ++ +E V D+K EN ++P +S+ +SS SED Sbjct: 348 VPEIEEEECVDDLKEENKSSPSSSSSSSSSSED 380 >At1g65220.1 68414.m07394 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein low similarity to SP|P47823 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Oryctolagus cuniculus}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 411 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 100 KYIKHL*RKMSTEAQNTDAAVEQVTQEVKDVKL 198 K IK + TE N D E V Q+VKD KL Sbjct: 254 KEIKAVLTSQVTEEINVDEVTEMVKQQVKDAKL 286 >At5g49840.1 68418.m06172 ATP-dependent Clp protease ATP-binding subunit ClpX, putative similar to CLP protease regulatory subunit CLPX GI:2674203 from [Arabidopsis thaliana]; non-consensus splice donor GC at exon 4; non-consensus splice donor AA at exon 7 Length = 606 Score = 27.9 bits (59), Expect = 6.1 Identities = 18/57 (31%), Positives = 32/57 (56%) Frame = +1 Query: 7 ATAGSISAATKSASLKRLSATDSLAYMISSHKYIKHL*RKMSTEAQNTDAAVEQVTQ 177 +T+G SAA S+ L+ L + D +AY + +++ L +S A N D V+ +T+ Sbjct: 428 STSGLSSAAVTSSLLESLQSEDLVAYGLIP-EFVGRLPILVSLSALNEDQLVQVLTE 483 >At5g58410.1 68418.m07314 expressed protein contains similarity to hypothetical proteins Length = 1873 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +1 Query: 331 LSQSDKWMKQAKVIDGKKITTTDTAIHFKKLKSVKLGIDDYQ-KFLDDLAKNKKVELDEI 507 LS++ W++ ++++DG K+ + ++ F K V + IDD + L + K K + +++ Sbjct: 588 LSKAFPWIRSSELLDGVKLLSVSVSV-FGPRKVVPVLIDDIETSTLLSVEKEKNMSPEKL 646 Query: 508 KK 513 K Sbjct: 647 IK 648 >At5g50260.1 68418.m06224 cysteine proteinase, putative similar to cysteine endopeptidase precursor CysEP GI:2944446 from [Ricinus communis] Length = 361 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +3 Query: 294 IWRSQVRWKSHHALAKRQMDETSQSY*WKENNNNGH 401 +W RW+SHH +A+ ++ + +K N + H Sbjct: 34 LWELYERWRSHHTVARSLEEKAKRFNVFKHNVKHIH 69 >At4g19490.2 68417.m02867 expressed protein Length = 1054 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +1 Query: 463 LDDLAKNKKVELDEIKKKLTTCGQPGITSHVTKSPAAAAAVDRLTDTSKYT 615 +D +A++ ++ DEI KL + + +H+ P +R DT+K T Sbjct: 897 IDKVAQDFRIHRDEIYTKLVQIMRERLLAHLHGLPKVVEGWNRPPDTNKQT 947 >At4g19490.1 68417.m02866 expressed protein Length = 1054 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +1 Query: 463 LDDLAKNKKVELDEIKKKLTTCGQPGITSHVTKSPAAAAAVDRLTDTSKYT 615 +D +A++ ++ DEI KL + + +H+ P +R DT+K T Sbjct: 897 IDKVAQDFRIHRDEIYTKLVQIMRERLLAHLHGLPKVVEGWNRPPDTNKQT 947 >At3g58260.1 68416.m06495 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 321 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 421 LKSVKLGIDDYQKFLDDLAKNKKVELDEIK 510 +KSV +D +K LD+L + KK E D+I+ Sbjct: 226 MKSVGFKLDWLEKKLDELFEKKKEEADKIR 255 >At3g28720.1 68416.m03586 expressed protein Length = 687 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 466 LETSGSRRCRVLPI*VF*SE*PCPLLLFSFHQ 371 +E G+ RVLP+ VF + PLLL +HQ Sbjct: 424 VEEEGNEFARVLPVYVFDLDINTPLLLDRYHQ 455 >At1g60090.1 68414.m06770 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to hydroxyisourate hydrolase (GI:19569603) [Glycine max] Length = 512 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 373 DGKKITTTDTAIHFKKLKSVKLGIDDYQKFLDDLAKNKKVELDEIK 510 DG+K + DT H + + + D Y K+ DD+ LD + Sbjct: 51 DGRKPSLWDTLCHSRDQGNGDIACDGYHKYKDDVKLMVDTNLDAFR 96 >At1g47610.1 68414.m05288 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein (GI:2739374) [Arabidopsis thaliana] Length = 351 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/36 (30%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 258 LIFQGSLQGVFQIWRSQVRWK-SHHALAKRQMDETS 362 L+F GS G ++W+ ++R K + H+L + + + S Sbjct: 189 LVFTGSADGTVKVWKREIRGKRTAHSLFQTLLKQES 224 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.309 0.124 0.334 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,461,055 Number of Sequences: 28952 Number of extensions: 268453 Number of successful extensions: 623 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -