BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0889 (639 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8I3B5 Cluster: Putative uncharacterized protein PFI016... 36 0.82 UniRef50_UPI00006CAFE6 Cluster: Protein kinase domain containing... 33 4.4 UniRef50_Q7N6P1 Cluster: Similarities with 2-amino-3-ketobutyrat... 33 4.4 >UniRef50_Q8I3B5 Cluster: Putative uncharacterized protein PFI0160w; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFI0160w - Plasmodium falciparum (isolate 3D7) Length = 3135 Score = 35.9 bits (79), Expect = 0.82 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = -3 Query: 220 RPQISQDFRPN--IGPVYILVKVTNSKI--NDMRPEDVVLIFLNNVCSNDLGYLN 68 + Q + FRPN IGPV ++K TNS+I ND + +D + NN N+L LN Sbjct: 1726 KDQKRESFRPNESIGPV--ILKTTNSRIIDNDKKEKDHPINIFNNSTFNNLNLLN 1778 >UniRef50_UPI00006CAFE6 Cluster: Protein kinase domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Protein kinase domain containing protein - Tetrahymena thermophila SB210 Length = 773 Score = 33.5 bits (73), Expect = 4.4 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = -3 Query: 214 QISQDFRPNIGPVYILVKVTNSKINDMRPEDVVLIFLNNVCSNDLGYLN 68 Q SQ + +I YIL K KI + +P +LI NN C+ +LG ++ Sbjct: 386 QCSQQKQTSIKDCYILGKKEFIKIENQQPSPKILIQENNKCNQNLGQID 434 >UniRef50_Q7N6P1 Cluster: Similarities with 2-amino-3-ketobutyrate coenzyme A ligase; n=2; Gammaproteobacteria|Rep: Similarities with 2-amino-3-ketobutyrate coenzyme A ligase - Photorhabdus luminescens subsp. laumondii Length = 448 Score = 33.5 bits (73), Expect = 4.4 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -3 Query: 199 FRPNIGPVYILVKVTNSKINDMRPEDVVLIFLNNVCSNDLGYLNLIHKIH--ICY*SDDI 26 F N+ PV + K ++ +N ++P + ND+GYL I KIH + Y +D + Sbjct: 164 FTGNVNPVMVFDKYSHYSMNHLKPSCADETEVITAPHNDMGYLEDICKIHKKVVYVADGV 223 Query: 25 F 23 + Sbjct: 224 Y 224 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 559,656,137 Number of Sequences: 1657284 Number of extensions: 10082228 Number of successful extensions: 24356 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24351 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 47711253245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -