BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0889 (639 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 28 5.4 02_04_0622 - 24508508-24508666,24509533-24509634,24510108-245101... 28 5.4 03_05_0331 - 23233883-23233972,23234099-23234164,23234300-232343... 28 7.2 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -3 Query: 271 NFTFFIGVTYTDKNKICRPQISQDFRPNI-GPVYILVKVTNSKI 143 N FF G+ Y IC + +DF ++ +Y K T+S I Sbjct: 462 NVVFFWGLMYRTSTNICIDSVKEDFMKSVTNDIYGKEKCTHSDI 505 >02_04_0622 - 24508508-24508666,24509533-24509634,24510108-24510176, 24510294-24510362,24510428-24510502,24510584-24510688, 24511309-24511407,24511521-24513230,24513489-24513788, 24514748-24514846,24514962-24515079,24515166-24515251, 24515334-24515402,24515746-24515843,24516373-24516534, 24516779-24516787,24516970-24516991,24517620-24517712, 24517872-24517940,24518720-24518782,24518882-24519037, 24520895-24521230 Length = 1355 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 616 RKIFQQMVTVTTNKNRSTKRIWTKY 542 R+ QQ+VT +TN + S IWTKY Sbjct: 1143 REALQQLVTASTNNDNS---IWTKY 1164 >03_05_0331 - 23233883-23233972,23234099-23234164,23234300-23234365, 23234451-23234675,23234794-23235279 Length = 310 Score = 27.9 bits (59), Expect = 7.2 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 73 DTPNHYYIHCSGKS 114 DTP+ YY+HC+G S Sbjct: 52 DTPSAYYLHCNGGS 65 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,571,453 Number of Sequences: 37544 Number of extensions: 254560 Number of successful extensions: 550 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -