BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0880 (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 30 0.019 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 30 0.019 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 25 0.54 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 25 0.54 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 25 0.54 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 25 0.54 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 25 0.71 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 25 0.71 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 24 0.94 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 24 0.94 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 23 2.9 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 3.8 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 5.0 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 22 5.0 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 21 6.6 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 8.7 AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 21 8.7 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 21 8.7 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 21 8.7 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 8.7 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 29.9 bits (64), Expect = 0.019 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%) Frame = +3 Query: 303 HTHSAKFPIEREVILSSGEKNSKVPILQEARKRGRLGAVAPDTPPKTLSA--WTHSENQA 476 H A + ++ + E + KV + G ++P+ P T +A + Q Sbjct: 412 HEPGAAYYQNENMLQKNAEYSGKVGYYENNHYNGDPNYISPEVFPNTNNAIMTPPASVQT 471 Query: 477 GTSADYRQYHENYNYNMQQNQSGTRNGNYDS 569 +S +Y +H+ Y+ QNQ N +S Sbjct: 472 ESSDNYNSFHQFYSSESSQNQVAPTGENSNS 502 Score = 22.6 bits (46), Expect = 2.9 Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 417 VAPDTPPKTLSAWTHSENQAGTSADYR--QYHENYNYNMQQN 536 V+ PP H NQ + +YR + H +Y M QN Sbjct: 269 VSNTIPPFASRGSMHFPNQYQMNQEYRTDRKHTQQHYQMNQN 310 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 29.9 bits (64), Expect = 0.019 Identities = 20/91 (21%), Positives = 37/91 (40%), Gaps = 2/91 (2%) Frame = +3 Query: 303 HTHSAKFPIEREVILSSGEKNSKVPILQEARKRGRLGAVAPDTPPKTLSA--WTHSENQA 476 H A + ++ + E + KV + G ++P+ P T +A + Q Sbjct: 360 HEPGAAYYQNENMLQKNAEYSGKVGYYENNHYNGDPNYISPEVFPNTNNAIMTPPASVQT 419 Query: 477 GTSADYRQYHENYNYNMQQNQSGTRNGNYDS 569 +S +Y +H+ Y+ QNQ N +S Sbjct: 420 ESSDNYNSFHQFYSSESSQNQVAPTGENSNS 450 Score = 22.6 bits (46), Expect = 2.9 Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 417 VAPDTPPKTLSAWTHSENQAGTSADYR--QYHENYNYNMQQN 536 V+ PP H NQ + +YR + H +Y M QN Sbjct: 217 VSNTIPPFASRGSMHFPNQYQMNQEYRTDRKHTQQHYQMNQN 258 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 25.0 bits (52), Expect = 0.54 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 501 YHENYNYNMQQNQSGTRNGNYDSPK 575 YH + NYN +G GNY P+ Sbjct: 64 YHNHQNYNSNVLSNGYGYGNYYHPQ 88 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 25.0 bits (52), Expect = 0.54 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 501 YHENYNYNMQQNQSGTRNGNYDSPK 575 YH + NYN +G GNY P+ Sbjct: 64 YHNHQNYNSNVLSNGYGYGNYYHPQ 88 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 25.0 bits (52), Expect = 0.54 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 501 YHENYNYNMQQNQSGTRNGNYDSPK 575 YH + NYN +G GNY P+ Sbjct: 64 YHNHQNYNSNVLSNGYGYGNYYHPQ 88 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 25.0 bits (52), Expect = 0.54 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 501 YHENYNYNMQQNQSGTRNGNYDSPK 575 YH + NYN +G GNY P+ Sbjct: 64 YHNHQNYNSNVLSNGYGYGNYYHPQ 88 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 471 QAGTSADYRQYHENYNYNMQQNQSGTRNGNY 563 Q T + Y+ +N+N Q NQ+ + NY Sbjct: 197 QYDTESSYQFNDPQFNFNYQYNQAYSNYNNY 227 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 24.6 bits (51), Expect = 0.71 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 471 QAGTSADYRQYHENYNYNMQQNQSGTRNGNY 563 Q T + Y+ +N+N Q NQ+ + NY Sbjct: 217 QYDTESSYQFNDPQFNFNYQYNQAYSNYNNY 247 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 24.2 bits (50), Expect = 0.94 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 255 PVLGASYTVGHCRVCQCRWRRRMNHLMYNN 166 P + T G+ VC+ RWR+ N + + N Sbjct: 364 PSINDDGTCGNGYVCEHRWRQIFNMVGFRN 393 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 24.2 bits (50), Expect = 0.94 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 255 PVLGASYTVGHCRVCQCRWRRRMNHLMYNN 166 P + T G+ VC+ RWR+ N + + N Sbjct: 365 PSINDDGTCGNGYVCEHRWRQIFNMVGFRN 394 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 22.6 bits (46), Expect = 2.9 Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 417 VAPDTPPKTLSAWTHSENQAGTSADYR--QYHENYNYNMQQN 536 V+ PP H NQ + +YR + H +Y M QN Sbjct: 400 VSNTIPPFASRGSMHFPNQYQMNQEYRTDRKHTQQHYQMNQN 441 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.2 bits (45), Expect = 3.8 Identities = 14/48 (29%), Positives = 19/48 (39%) Frame = -1 Query: 546 YHSDSAACCNCSSRGIVCSRPMCRLGSPSESRLRVFLVGCREPRRRVC 403 YH+ S AC +C C R C G ++ + V P VC Sbjct: 66 YHTLSKACYDCPYNTQDCYREDCIPGDGNKRSIIVVNRKMPGPSVEVC 113 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/58 (18%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +3 Query: 411 GAVAPD-TPPKTLSAWTHSENQAGTSADYRQYHENYNYNMQQNQSGTRNGNYDSPKPP 581 G + P +PP T + + + Q+H+ ++ G + N PP Sbjct: 147 GVLGPTGSPPLTTQSMNNHHMGHHMQEQHPQHHQPHHQQQHMMYGGQQGANMHQQGPP 204 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/58 (18%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +3 Query: 411 GAVAPD-TPPKTLSAWTHSENQAGTSADYRQYHENYNYNMQQNQSGTRNGNYDSPKPP 581 G + P +PP T + + + Q+H+ ++ G + N PP Sbjct: 149 GVLGPTGSPPLTTQSMNNHHMGHHMQEQHPQHHQPHHQQQHMMYGGQQGANMHQQGPP 206 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 259 RRCLESQRLPDLPPC 303 + C ES+ + D PPC Sbjct: 1 KNCSESKAICDNPPC 15 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 344 YHFSFYRKFCGV 309 YH YRKFC + Sbjct: 29 YHKEKYRKFCRI 40 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/25 (24%), Positives = 16/25 (64%) Frame = -1 Query: 126 DFRLIHKTQIIETLKCSRKTMKGFN 52 ++ L+ +++ L+C+ T +GF+ Sbjct: 167 EYILMQTNKLVLALECNNSTSEGFD 191 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/25 (24%), Positives = 16/25 (64%) Frame = -1 Query: 126 DFRLIHKTQIIETLKCSRKTMKGFN 52 ++ L+ +++ L+C+ T +GF+ Sbjct: 167 EYILMQTNKLVLALECNNSTSEGFD 191 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/25 (24%), Positives = 16/25 (64%) Frame = -1 Query: 126 DFRLIHKTQIIETLKCSRKTMKGFN 52 ++ L+ +++ L+C+ T +GF+ Sbjct: 167 EYILMQTNKLVLALECNNSTSEGFD 191 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +3 Query: 570 PKPPVPAKTYGTKIDATNNSQQITVT 647 P PP P++ K NN+ ++ T Sbjct: 72 PSPPAPSELPALKSRKLNNNNVVSST 97 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,623 Number of Sequences: 336 Number of extensions: 3478 Number of successful extensions: 24 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -