BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0879 (663 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81107-3|CAE45743.1| 295|Caenorhabditis elegans Hypothetical pr... 93 1e-19 Z81107-2|CAB03226.2| 270|Caenorhabditis elegans Hypothetical pr... 93 1e-19 >Z81107-3|CAE45743.1| 295|Caenorhabditis elegans Hypothetical protein R07H5.3b protein. Length = 295 Score = 93.5 bits (222), Expect = 1e-19 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 4/116 (3%) Frame = +1 Query: 241 IDSFATYGFKLNNGITVLGPMAIFPRTVLSWQVADSDDVTEESLKLFKLLEPRXXXXXXX 420 + + YGF+L +G + GP+A+FP+T LSW+V +D+T SL LF LEP+ Sbjct: 97 VRGLSCYGFRLLDGTFLYGPIALFPKTALSWRVPTPEDITPRSLALFAALEPK--IDILV 154 Query: 421 XXXXXRSKIDKAFKAA----RANELNIEILATEHACSTFNFLNAEGRSVAAALIPP 576 + IDK + R +++ +EI+ TE A +TFNFLNAEGR V AAL PP Sbjct: 155 LGVGDKKNIDKVRASVAPFLREHKIGLEIMDTEDAIATFNFLNAEGRYVGAALYPP 210 >Z81107-2|CAB03226.2| 270|Caenorhabditis elegans Hypothetical protein R07H5.3a protein. Length = 270 Score = 93.5 bits (222), Expect = 1e-19 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 4/116 (3%) Frame = +1 Query: 241 IDSFATYGFKLNNGITVLGPMAIFPRTVLSWQVADSDDVTEESLKLFKLLEPRXXXXXXX 420 + + YGF+L +G + GP+A+FP+T LSW+V +D+T SL LF LEP+ Sbjct: 72 VRGLSCYGFRLLDGTFLYGPIALFPKTALSWRVPTPEDITPRSLALFAALEPK--IDILV 129 Query: 421 XXXXXRSKIDKAFKAA----RANELNIEILATEHACSTFNFLNAEGRSVAAALIPP 576 + IDK + R +++ +EI+ TE A +TFNFLNAEGR V AAL PP Sbjct: 130 LGVGDKKNIDKVRASVAPFLREHKIGLEIMDTEDAIATFNFLNAEGRYVGAALYPP 185 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,064,991 Number of Sequences: 27780 Number of extensions: 283473 Number of successful extensions: 649 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -