BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0876 (579 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0V4N5 Cluster: Predicted protein; n=1; Phaeosphaeria n... 40 0.032 UniRef50_Q4YU13 Cluster: Putative uncharacterized protein; n=1; ... 33 3.7 >UniRef50_Q0V4N5 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 1203 Score = 40.3 bits (90), Expect = 0.032 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = +1 Query: 415 SEAQVGSFCFYIASICTVVSFIFLEVSTRVLQINVIFFERMFVIKSYPM 561 ++A GSF F+IA IC V SF F +V L +++ MF +K +P+ Sbjct: 378 TQANFGSFAFHIACICAVTSFFFCQVQD-TLPRDLLLEHNMFPLKFFPL 425 >UniRef50_Q4YU13 Cluster: Putative uncharacterized protein; n=1; Plasmodium berghei|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 1027 Score = 33.5 bits (73), Expect = 3.7 Identities = 22/77 (28%), Positives = 41/77 (53%) Frame = -1 Query: 519 YIDLKNTSRNFQKNKRYHSTYRGDIKTE*SDLCF*CRDNLTSLFLPTKQSVSLRHLRTSY 340 Y L TS+ ++KNK+ H + GDI C DN+ SL+ K++++ + + S Sbjct: 490 YDKLYKTSKEYKKNKKSHPEWEGDI----------CIDNIFSLYSNGKENITDKVNKNS- 538 Query: 339 RIQGTSNL*YSSLVHLD 289 + G++N+ + L +D Sbjct: 539 KFHGSNNIMNTILDEID 555 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 487,905,322 Number of Sequences: 1657284 Number of extensions: 8826981 Number of successful extensions: 19583 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19576 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 39987623712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -