BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0876 (579 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6724| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_18359| Best HMM Match : UPF0171 (HMM E-Value=1e-09) 27 8.4 >SB_6724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 399 TSLFLPTKQSVSLRHLRTSYRIQGTSNL*YSSLVHLDQCVIR 274 TSL L Q L +LR + I+ L + ++ H QCV R Sbjct: 622 TSLALHNYQKARLEYLREQFNIRENDFLTFDAMRHAAQCVGR 663 >SB_18359| Best HMM Match : UPF0171 (HMM E-Value=1e-09) Length = 557 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +1 Query: 424 QVGSFCFYIASICTVVSFIFLEVSTRVLQINVIFFERMFVIKSY 555 +V +CFY ++C S + V +R +I +F +++F I ++ Sbjct: 295 EVPPYCFYSTAVCNSGSSLLTSVISRFHRI--VFIQQVFAIAAH 336 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,442,223 Number of Sequences: 59808 Number of extensions: 284007 Number of successful extensions: 554 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -