BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0876 (579 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 26 0.77 Z49815-1|CAA89969.1| 237|Anopheles gambiae serine proteinase pr... 23 9.5 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 26.2 bits (55), Expect = 0.77 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = -3 Query: 355 SSD*LQNTRNI---KSII*FTGSFRSMCNSLNFNHTF 254 S+D + T+N+ KS+ F GSF C+ NF H + Sbjct: 1495 SNDSDETTKNLPWLKSVSNFLGSFNYYCDHQNFCHPY 1531 >Z49815-1|CAA89969.1| 237|Anopheles gambiae serine proteinase protein. Length = 237 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 411 DIRSTSRIILFLYRLYMYCG 470 D++ I++ LYR YCG Sbjct: 8 DVKEYPWIVMLLYRGAFYCG 27 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 539,710 Number of Sequences: 2352 Number of extensions: 9780 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -