BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0875 (738 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000F201B5 Cluster: PREDICTED: hypothetical protein;... 36 1.4 UniRef50_Q4Y148 Cluster: Putative uncharacterized protein; n=5; ... 33 7.3 UniRef50_A7SDL1 Cluster: Predicted protein; n=4; Eumetazoa|Rep: ... 33 7.3 >UniRef50_UPI0000F201B5 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 243 Score = 35.5 bits (78), Expect = 1.4 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +3 Query: 582 TLVNNNQIL*LHEVKGTTFLCLCASSIGTVPKNNDIP 692 TL+ N L + EVKG + C+ SS+GTV + +IP Sbjct: 167 TLIANGSRLDISEVKGVNYTCVIKSSLGTVMTHYEIP 203 >UniRef50_Q4Y148 Cluster: Putative uncharacterized protein; n=5; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 2771 Score = 33.1 bits (72), Expect = 7.3 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = -3 Query: 433 ICMETYLLTFYI*MELFVMEKYISKIGKNVKKKLNIIVLDTYF 305 IC ETY+ ++ + + EKYI K KN++K+ N +V D Y+ Sbjct: 1655 IC-ETYINPYFY-INTYYFEKYIRKRYKNLRKEDNYLVYDFYY 1695 >UniRef50_A7SDL1 Cluster: Predicted protein; n=4; Eumetazoa|Rep: Predicted protein - Nematostella vectensis Length = 187 Score = 33.1 bits (72), Expect = 7.3 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 592 TIIRYYSYTKLKALHFYVYVHHLLEPYPKTMTYLSRYHWTEL 717 T+ Y S+ ++ ++++HH L YP + Y+S HW + Sbjct: 96 TLATYPSHIGYISITHWLHIHHTLATYPSHIGYISITHWLHI 137 Score = 33.1 bits (72), Expect = 7.3 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 592 TIIRYYSYTKLKALHFYVYVHHLLEPYPKTMTYLSRYHWTEL 717 T+ Y S+ ++ ++++HH L YP + Y+S HW + Sbjct: 118 TLATYPSHIGYISITHWLHIHHTLATYPSHIGYISITHWLHI 159 Score = 33.1 bits (72), Expect = 7.3 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 592 TIIRYYSYTKLKALHFYVYVHHLLEPYPKTMTYLSRYHWTEL 717 T+ Y S+ ++ ++++HH L YP + Y+S HW + Sbjct: 140 TLATYPSHIGYISITHWLHIHHTLATYPSHIGYISIKHWLHI 181 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,568,104 Number of Sequences: 1657284 Number of extensions: 12711574 Number of successful extensions: 24240 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24229 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60088620670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -