BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0870 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 49 5e-08 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 6.4 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 48.8 bits (111), Expect = 5e-08 Identities = 27/91 (29%), Positives = 54/91 (59%) Frame = +3 Query: 342 DKVVIITGGANGIGESFVQNLLEEDIKFIAILDTDVEAGEMLQDKMMTEYANSKVKFIQC 521 D+V ++TG +GIG+ ++ L+ + +K I I V+ + L +++ ++ K+ +QC Sbjct: 7 DEVALVTGANSGIGKCLIECLVGKGMKVIGIAP-QVDKMKTLVEELKSK--PGKLVPLQC 63 Query: 522 DVTVDEELFGAFDDVVKEIGYIDLVINNAGI 614 D++ ++ + V K +G ID++INNA I Sbjct: 64 DLSNQNDILKVIEWVEKNLGAIDILINNATI 94 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +3 Query: 315 TIIEMYDLKDKVVIITGGANGIGESFVQNLLEEDIKFIAILD 440 TI+ M D K +I+ ++ N + D K+I ++D Sbjct: 202 TIVYMADDKGDALIVYQNSDESFHRLTSNTFDYDPKYIKMMD 243 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,984 Number of Sequences: 438 Number of extensions: 3181 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -