BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0867 (719 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 24 1.7 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 22 6.7 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 22 6.7 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.8 bits (49), Expect = 1.7 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -3 Query: 192 LPFYKDWKIYKTWL 151 LPF W+++K W+ Sbjct: 119 LPFSATWEVFKVWI 132 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 21.8 bits (44), Expect = 6.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 464 SSEKAEQLKKM*SRDCISLLQ*LQTGEDKTLI 559 SS+ LKK S+D L+ +T D TL+ Sbjct: 3 SSDSKSLLKKYLSKDVFDQLKTKKTSFDSTLL 34 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.8 bits (44), Expect = 6.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 464 SSEKAEQLKKM*SRDCISLLQ*LQTGEDKTLI 559 SS+ LKK S+D L+ +T D TL+ Sbjct: 19 SSDSKSLLKKYLSKDVFDQLKTKKTSFDSTLL 50 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,993 Number of Sequences: 438 Number of extensions: 4469 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -