BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0862 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54270.1 68416.m05998 sucrose-phosphatase 3 (SPP3) nearly ide... 28 5.2 At1g23880.1 68414.m03012 NHL repeat-containing protein contains ... 27 9.0 >At3g54270.1 68416.m05998 sucrose-phosphatase 3 (SPP3) nearly identical to sucrose-phosphatase (SPP3) [Arabidopsis thaliana] GI:16904077 Length = 425 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 368 KNKPILFFRSLIWRSHMTHKALLVQCT 288 +N +L F +L W +H H +LLV CT Sbjct: 27 ENNDLLRFNAL-WEAHYRHDSLLVYCT 52 >At1g23880.1 68414.m03012 NHL repeat-containing protein contains Pfam profile PF01436: NHL repeat Length = 545 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 367 FYLCFSLLFQYFMLILCYSACFFFYVVNTKAYVSFTIFSL 486 FY S+LF F+ S FFF ++ SF I ++ Sbjct: 7 FYASLSILFCCFLFFFNLSPSFFFLRLSRSVTTSFNILNI 46 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,202,074 Number of Sequences: 28952 Number of extensions: 243059 Number of successful extensions: 541 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -