BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0861 (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 6.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.9 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 6.0 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 247 DGNIVLASFELPESNIDCDTTLTLSL*YCPIPKHI*RILY 128 DG+IV F L E + C L L + P I I+Y Sbjct: 218 DGSIVFVCFSLVEDTLPCVFFLGSILIFFIFPLAILIIVY 257 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.0 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 550 ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 422 +S ++ + N L V FLL K L + W G+ +YDE Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.0 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 550 ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 422 +S ++ + N L V FLL K L + W G+ +YDE Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -3 Query: 581 CCLRAIQKWARKRQQLGCSQSS*CMRIL 498 CC A+ RQ + S+ C+R + Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -3 Query: 581 CCLRAIQKWARKRQQLGCSQSS*CMRIL 498 CC A+ RQ + S+ C+R + Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIRYM 534 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,938 Number of Sequences: 336 Number of extensions: 4412 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -