BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0856 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9457| Best HMM Match : PHD (HMM E-Value=3.3e-08) 47 2e-05 SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_32425| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) 38 0.006 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 38 0.011 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_36593| Best HMM Match : PHD (HMM E-Value=3.4e-18) 36 0.032 SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_5031| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) 33 0.23 SB_3579| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_19925| Best HMM Match : TUDOR (HMM E-Value=2) 32 0.40 SB_5207| Best HMM Match : TUDOR (HMM E-Value=3.1) 32 0.40 SB_50761| Best HMM Match : RCSD (HMM E-Value=4.4) 32 0.52 SB_6176| Best HMM Match : Bromo_TP (HMM E-Value=1.5e-23) 32 0.52 SB_17346| Best HMM Match : PHD (HMM E-Value=2.1e-09) 32 0.52 SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) 31 0.69 SB_22901| Best HMM Match : PHD (HMM E-Value=5.3e-05) 31 0.69 SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) 31 0.69 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_10962| Best HMM Match : PHD (HMM E-Value=5.3e-05) 31 0.69 SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_24946| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_14389| Best HMM Match : PHD (HMM E-Value=0.0005) 31 1.2 SB_10929| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_39590| Best HMM Match : PHD (HMM E-Value=2.2e-18) 30 1.6 SB_38403| Best HMM Match : PP2C (HMM E-Value=8.5e-35) 30 1.6 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.6 SB_58672| Best HMM Match : PHD (HMM E-Value=3e-18) 30 1.6 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 30 1.6 SB_9857| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_9001| Best HMM Match : PHD (HMM E-Value=0.00096) 30 2.1 SB_6668| Best HMM Match : PHD (HMM E-Value=0.00096) 30 2.1 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_44702| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.03) 29 3.7 SB_17974| Best HMM Match : PAN (HMM E-Value=0.004) 29 3.7 SB_33862| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_17329| Best HMM Match : S-antigen (HMM E-Value=0.31) 29 4.9 SB_14079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_59382| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_55139| Best HMM Match : PAN (HMM E-Value=0.055) 29 4.9 SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) 29 4.9 SB_20264| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) 28 6.5 SB_14778| Best HMM Match : MH1 (HMM E-Value=2.8026e-45) 28 6.5 SB_3140| Best HMM Match : C1_3 (HMM E-Value=7) 28 6.5 SB_20744| Best HMM Match : CH (HMM E-Value=0.92) 28 6.5 SB_2877| Best HMM Match : Hom_end (HMM E-Value=1.1) 28 8.5 SB_58276| Best HMM Match : MIB_HERC2 (HMM E-Value=8.3e-33) 28 8.5 SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_9457| Best HMM Match : PHD (HMM E-Value=3.3e-08) Length = 344 Score = 46.8 bits (106), Expect = 2e-05 Identities = 28/78 (35%), Positives = 36/78 (46%), Gaps = 3/78 (3%) Frame = +1 Query: 373 ADDGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPPV---DAWINGASWHCK 543 A D + C VC E TG N ++ C C YH KCH P V DA W+C Sbjct: 159 AIDLGVSCSVCDHSENKMTG---NKLVECHECHSHYHQKCHEPRVSDEDANDLRLVWYCT 215 Query: 544 RCVDQRYRVAAAENRALK 597 C+ ++ R A + ALK Sbjct: 216 LCI-KKMREATSSTTALK 232 >SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 44.8 bits (101), Expect = 7e-05 Identities = 21/57 (36%), Positives = 25/57 (43%) Frame = +1 Query: 379 DGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 D I C C + T N ++ CD C RGYH C P + GA WHC C Sbjct: 96 DEMIKCAECLKPSMYNTIHTKNELLLCDNCDRGYHMSCLDPKLTKAPKGA-WHCVLC 151 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +1 Query: 394 CVVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRCV 552 C+ C EG G ++ CD C YH C PP++ + W CK CV Sbjct: 797 CLDCTLCEGCGKGSDEARLLLCDSCDISYHTYCLDPPLEK-VPPGGWKCKWCV 848 Score = 31.5 bits (68), Expect = 0.69 Identities = 16/53 (30%), Positives = 21/53 (39%) Frame = +1 Query: 391 MCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 MC+ C GP +I C CG+ +H C V+ I W C C Sbjct: 752 MCLCCGSF---GKGPE-GQLIVCSQCGQCFHPYCVGVKVNKMILSKGWRCLDC 800 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 40.3 bits (90), Expect = 0.001 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 +I CD C R YH +CH PP+ ++ SW C C Sbjct: 999 LICCDGCPRVYHRECHHPPL-RYVPRGSWVCSGC 1031 Score = 37.1 bits (82), Expect = 0.014 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +1 Query: 388 IMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC--VDQR 561 + C VC+R+ + ++ CD C GYH C P +D I W C C V +R Sbjct: 897 VKCKVCRRKSR-----SDETLLLCDECNMGYHLFCLRPSLDR-IPLGEWKCPACKPVTRR 950 Query: 562 YRVAAAEN 585 R + N Sbjct: 951 ERTNRSYN 958 >SB_32425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/64 (31%), Positives = 30/64 (46%) Frame = +1 Query: 379 DGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRCVDQ 558 D +C +C +G +N I+ CDMC H +C+ P +I W C+RC+ Sbjct: 255 DEDAVCCICN--DGECQN--SNVILFCDMCNLAVHQECYGVP---YIPEGQWLCRRCLQS 307 Query: 559 RYRV 570 RV Sbjct: 308 PSRV 311 >SB_49136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +1 Query: 430 GPATNAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRCVDQRYRVAAAENRALKR 600 GPA + CD C R +H KC PP+ + SW C +C +R + + + K+ Sbjct: 1201 GPA-GKMAKCDNCPRNFHLKCLEPPL-VKMPRVSWTCPKCKKRRAKNSTPRRKREKK 1255 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 385 RIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKC 492 ++ C +C+ TG ++ CD C RGYH C Sbjct: 1158 KVFCQMCR------TGDNEELLLLCDGCDRGYHTYC 1187 >SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) Length = 389 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +1 Query: 397 VVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 V+ R P P + ++ CD C RGYH C +PP+D G W C C Sbjct: 319 VLMPRTPKPCLIPQ-DQLLFCDDCDRGYHMYCLNPPMDKPPEG-HWMCSLC 367 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/52 (36%), Positives = 26/52 (50%) Frame = +1 Query: 394 CVVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 C +C RR+G A ++ CD C RG+H C PP+ I +W C C Sbjct: 1627 CKLC-RRKGDA-----EKMLLCDACDRGHHMYCLKPPI-KHIPEGNWFCPDC 1671 Score = 34.7 bits (76), Expect = 0.074 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC--VDQRYRVAAAENRALKRSDLFRFK 621 ++ CD+C YH C PP+ G +W C+ C D+ A ++ + L + K Sbjct: 1739 LLCCDICPLAYHVHCAYPPLRRVPRG-NWACQVCTGADEDRSSKARVKKSTIKEALKKAK 1797 Query: 622 GGQ-PTKAT 645 G Q P AT Sbjct: 1798 GKQKPGSAT 1806 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 ++ CD C YH KC PP+ G W C RC Sbjct: 461 LLCCDKCPMAYHLKCLIPPMMRVPTG-EWKCPRC 493 >SB_36593| Best HMM Match : PHD (HMM E-Value=3.4e-18) Length = 134 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 ++ CD C YH KC PP+ G W C RC Sbjct: 23 LLCCDKCPMAYHLKCLIPPMMRVPTG-EWKCPRC 55 >SB_6618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 34.7 bits (76), Expect = 0.074 Identities = 17/73 (23%), Positives = 33/73 (45%) Frame = +1 Query: 331 WAPVSSLKLLSVPPADDGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPPVD 510 W+ + K++ +D C VC + + ++ CD C +GYH +C + P++ Sbjct: 132 WSKIPVEKVIEEEEWEDEPTYCEVCHDCD------REDRLLLCDDCDKGYHMECLTSPLE 185 Query: 511 AWINGASWHCKRC 549 ++ W C C Sbjct: 186 -FVPIEEWFCPIC 197 >SB_5031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 34.7 bits (76), Expect = 0.074 Identities = 19/66 (28%), Positives = 30/66 (45%) Frame = +1 Query: 217 RYYLGTIIELSTSNDNDLCEVGASVARCLVKFGDGTHSWAPVSSLKLLSVPPADDGRIMC 396 +YY G I+E+ +SN RC V+F DG WA +++L A D + Sbjct: 24 KYYAGRIVEVDSSNSQQ--------PRCHVQFDDGDKEWAEAGFIRMLPEVAAADLGVPS 75 Query: 397 VVCKRR 414 ++ R Sbjct: 76 IITNSR 81 Score = 32.3 bits (70), Expect = 0.40 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +1 Query: 217 RYYLGTIIELSTSNDNDLCEVGASVARCLVKFGDGTHSWAPVSSLKLLSVP-PADDGRIM 393 +YYLGT+ N + + E + VK+ DG SW V+ L+++ P PA + + M Sbjct: 385 KYYLGTV---DAVNKDQMYE-----PQYHVKYDDGDESWVTVNQLRVIPAPGPAPESQFM 436 Query: 394 CV 399 V Sbjct: 437 VV 438 >SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) Length = 651 Score = 33.1 bits (72), Expect = 0.23 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 9/67 (13%) Frame = +1 Query: 376 DDGRIMCVVCKRREGPATG-------PATNAIIACDMCGRGYHAKCHSPPVDAWIN-GAS 531 +DG+I+C VCK+ A+ ++N AC+ C + +H K + +I+ G Sbjct: 493 EDGKIVCTVCKKTXNRASNLYTHMRTHSSNKXHACEFCSKRFHQKA-DLRIHRYIHTGEK 551 Query: 532 WH-CKRC 549 H CK+C Sbjct: 552 PHKCKKC 558 >SB_3579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 436 ATNAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 A+ ++ CD C YH C PP+ I W C +C Sbjct: 192 ASGELLMCDTCTLVYHLSCLDPPLTT-IPTGMWICPKC 228 >SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 941 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +1 Query: 442 NAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 + I+ CD C YH C PP+ I W C C Sbjct: 228 DTILLCDKCDAAYHTACLRPPL-LTIPQGDWFCPFC 262 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 32.3 bits (70), Expect = 0.40 Identities = 22/80 (27%), Positives = 32/80 (40%), Gaps = 2/80 (2%) Frame = +1 Query: 352 KLLSVPPADDGRIMCVV--CKRREGPATGPATNAIIACDMCGRGYHAKCHSPPVDAWING 525 +L++V D+ C C R G G + CD C R YH C + Sbjct: 1470 ELVNVEDDDEEEDPCAAASCSRPIGEEVG-----WVQCDQCERWYHLVCIGLSSERAEAL 1524 Query: 526 ASWHCKRCVDQRYRVAAAEN 585 S+HCK C Q + + E+ Sbjct: 1525 DSYHCKLCTGQVVNLTSTES 1544 >SB_19925| Best HMM Match : TUDOR (HMM E-Value=2) Length = 263 Score = 32.3 bits (70), Expect = 0.40 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +1 Query: 217 RYYLGTIIELSTSNDNDLCEVGASVARCLVKFGDGTHSWAPVSSLKLLSVP-PADDGRIM 393 +YYLGT+ N + + E + VK+ DG SW V+ L+++ P PA + + M Sbjct: 181 KYYLGTV---DAVNKDQMYE-----PQYHVKYDDGDESWVTVNQLRVIPAPGPAPESQFM 232 Query: 394 CV 399 V Sbjct: 233 VV 234 >SB_5207| Best HMM Match : TUDOR (HMM E-Value=3.1) Length = 364 Score = 32.3 bits (70), Expect = 0.40 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +1 Query: 217 RYYLGTIIELSTSNDNDLCEVGASVARCLVKFGDGTHSWAPVSSLKLLSVP-PADDGRIM 393 +YYLGT+ N + + E + VK+ DG SW V+ L+++ P PA + + M Sbjct: 224 KYYLGTV---DAVNKDQMYE-----PQYHVKYDDGDESWVTVNQLRVIPAPGPAPESQFM 275 Query: 394 CV 399 V Sbjct: 276 VV 277 >SB_50761| Best HMM Match : RCSD (HMM E-Value=4.4) Length = 482 Score = 31.9 bits (69), Expect = 0.52 Identities = 19/51 (37%), Positives = 24/51 (47%) Frame = +2 Query: 404 ASDARGLPLDRPPTLSSRATCVAEATTPNVTRPPSMPGSMVHHGIVKGVLT 556 AS AR P+ RP T S EA T N RPPS ++K +L+ Sbjct: 427 ASAAR--PVSRPQTQQSLYIPPTEALTQNAQRPPSHQSIKSQQSVIKSILS 475 >SB_6176| Best HMM Match : Bromo_TP (HMM E-Value=1.5e-23) Length = 684 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +1 Query: 421 PATGPATNA--IIACDMCGRGYHAKCHSPPVDAWINGASWHCKRCVDQR 561 PA G A + +I CD C + YH C D G W+C C ++ Sbjct: 621 PACGFADDGSFMIGCDSCDKWYHGSCVGVLDDP---GGDWYCVHCTAKK 666 >SB_17346| Best HMM Match : PHD (HMM E-Value=2.1e-09) Length = 238 Score = 31.9 bits (69), Expect = 0.52 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSPPVDAWINGASWHCKRCVDQRY 564 ++ C+ CGR YH C P A W C+ CV++ + Sbjct: 188 MVQCEACGRWYHCACVRVPPTA--VHKEWLCELCVNKAH 224 >SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 790 Score = 31.5 bits (68), Expect = 0.69 Identities = 24/101 (23%), Positives = 38/101 (37%), Gaps = 4/101 (3%) Frame = +1 Query: 358 LSVPPADDGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHS---PPVDAWINGA 528 +S+ P + C +CK+ P + CD C HAKC P ++ N + Sbjct: 82 ISLNPGPAWKYPCGLCKK---PVKSNQRG--LQCDSCNIWNHAKCMDISIPSYESLANSS 136 Query: 529 S-WHCKRCVDQRYRVAAAENRALKRSDLFRFKGGQPTKATA 648 W C +C + L+ S+ F F Q + A Sbjct: 137 CLWLCPKCDASNFSETLLSASTLELSNSFNFLPSQTSSPVA 177 >SB_22901| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 696 Score = 31.5 bits (68), Expect = 0.69 Identities = 24/101 (23%), Positives = 38/101 (37%), Gaps = 4/101 (3%) Frame = +1 Query: 358 LSVPPADDGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHS---PPVDAWINGA 528 +S+ P + C +CK+ P + CD C HAKC P ++ N + Sbjct: 86 ISLNPGPAWKYPCGLCKK---PVKSNQRG--LQCDSCNIWNHAKCMDISIPSYESLANSS 140 Query: 529 S-WHCKRCVDQRYRVAAAENRALKRSDLFRFKGGQPTKATA 648 W C +C + L+ S+ F F Q + A Sbjct: 141 CLWLCPKCDASNFSKTLLSASTLELSNSFNFLPSQTSSPVA 181 >SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 822 Score = 31.5 bits (68), Expect = 0.69 Identities = 24/101 (23%), Positives = 38/101 (37%), Gaps = 4/101 (3%) Frame = +1 Query: 358 LSVPPADDGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHS---PPVDAWINGA 528 +S+ P + C +CK+ P + CD C HAKC P ++ N + Sbjct: 86 ISLNPGPAWKYPCGLCKK---PVKSNQRG--LQCDSCNIWNHAKCMDISIPSYESLANSS 140 Query: 529 S-WHCKRCVDQRYRVAAAENRALKRSDLFRFKGGQPTKATA 648 W C +C + L+ S+ F F Q + A Sbjct: 141 CLWLCPKCDASNFSETLLSASTLELSNSFNFLPSQTSSPVA 181 >SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2123 Score = 31.5 bits (68), Expect = 0.69 Identities = 24/101 (23%), Positives = 38/101 (37%), Gaps = 4/101 (3%) Frame = +1 Query: 358 LSVPPADDGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHS---PPVDAWINGA 528 +S+ P + C +CK+ P + CD C HAKC P ++ N + Sbjct: 1233 ISLNPGPAWKYPCGLCKK---PVKSNQRG--LQCDSCNIWNHAKCMDISIPSYESLANSS 1287 Query: 529 S-WHCKRCVDQRYRVAAAENRALKRSDLFRFKGGQPTKATA 648 W C +C + L+ S+ F F Q + A Sbjct: 1288 CLWLCPKCDASNFSETLLSASTLELSNSFNFLPSQTSSPVA 1328 >SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 913 Score = 31.5 bits (68), Expect = 0.69 Identities = 24/101 (23%), Positives = 38/101 (37%), Gaps = 4/101 (3%) Frame = +1 Query: 358 LSVPPADDGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHS---PPVDAWINGA 528 +S+ P + C +CK+ P + CD C HAKC P ++ N + Sbjct: 65 ISLNPGPAWKYPCGLCKK---PVKSNQRG--LQCDSCNIWNHAKCMDISIPSYESLANSS 119 Query: 529 S-WHCKRCVDQRYRVAAAENRALKRSDLFRFKGGQPTKATA 648 W C +C + L+ S+ F F Q + A Sbjct: 120 CLWLCPKCDASNFSETLLSASTLELSNSFNFLPSQTSSPVA 160 >SB_10962| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 521 Score = 31.5 bits (68), Expect = 0.69 Identities = 24/101 (23%), Positives = 38/101 (37%), Gaps = 4/101 (3%) Frame = +1 Query: 358 LSVPPADDGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHS---PPVDAWINGA 528 +S+ P + C +CK+ P + CD C HAKC P ++ N + Sbjct: 86 ISLNPGPAWKYPCGLCKK---PVKSNQRG--LQCDSCNIWNHAKCMDISIPSYESLANSS 140 Query: 529 S-WHCKRCVDQRYRVAAAENRALKRSDLFRFKGGQPTKATA 648 W C +C + L+ S+ F F Q + A Sbjct: 141 CLWLCPKCDASNFSETLLSASTLELSNSFNFLPSQTSSPVA 181 >SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2834 Score = 31.1 bits (67), Expect = 0.92 Identities = 15/55 (27%), Positives = 22/55 (40%) Frame = +1 Query: 436 ATNAIIACDMCGRGYHAKCHSPPVDAWINGASWHCKRCVDQRYRVAAAENRALKR 600 AT + CD+C +H C + + W CK C ++ V E L R Sbjct: 2773 ATRFYVGCDLCANWFHGACVNITPEEAAAMDHWSCKDCKREQQDVEQEEVYCLCR 2827 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 ++ C++C YH +C PP++ G W C C Sbjct: 279 LLCCEICPGVYHLQCLKPPLEQVPTG-DWLCPVC 311 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 31.1 bits (67), Expect = 0.92 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 5/43 (11%) Frame = +1 Query: 451 IACDMCGRGYHAKCHSPPVDAWIN-----GASWHCKRCVDQRY 564 I CD CG+ HAKC S ++++ +W C C+ + Sbjct: 225 ICCDECGQWTHAKCISMSYNSYLRYSNNPNLTWICSSCLSPNF 267 >SB_24946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 822 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSPPVDAWINGASWHC 540 ++ CD C G+H C +PP+ +G W C Sbjct: 208 LVQCDFCPLGFHMDCINPPLTTPPSG-MWMC 237 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/35 (31%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSPPVDA-WINGASWHCKRC 549 ++ CD C +H C PP++ I W C C Sbjct: 61 LLCCDQCPCAFHLSCCDPPLEEDDIPDGEWLCIEC 95 >SB_14389| Best HMM Match : PHD (HMM E-Value=0.0005) Length = 82 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSPPVDAWINGASWHC 540 ++ CD C G+H C +PP+ +G W C Sbjct: 8 LVQCDFCPLGFHMDCINPPLTTPPSG-MWMC 37 >SB_10929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 636 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = +1 Query: 451 IACDMCGRGYHAKCHSPPVDAW--INGA--SWHCKRC 549 + CD C + YH +C P + + +N + SW C C Sbjct: 109 VQCDSCDKWYHVRCMDMPTEVYQGLNNSCTSWICCTC 145 >SB_39590| Best HMM Match : PHD (HMM E-Value=2.2e-18) Length = 1284 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 13/47 (27%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSP--PV------DAWINGASW-----HCKRC 549 ++ CD C RGYH C P PV D W A W HC C Sbjct: 875 LLMCDKCQRGYHVDCLGPSYPVVSEGSEDTWDPEAVWMHEFTHCYDC 921 >SB_38403| Best HMM Match : PP2C (HMM E-Value=8.5e-35) Length = 916 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/74 (24%), Positives = 36/74 (48%) Frame = +1 Query: 85 ASKKNEKKEEETQDAMPDSTTSTEKNNANPFHCGDDVLVANKDGRYYLGTIIELSTSNDN 264 AS++ + EEE ++ + + E+ + G+ VLV + + Y GT ++ DN Sbjct: 222 ASEEPQDGEEEEEEEEEEESEEEEEEEED--EDGEGVLVKSDEAGYDSGTTAIVALVKDN 279 Query: 265 DLCEVGASVARCLV 306 +L +RC++ Sbjct: 280 NLTVANVGDSRCVL 293 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/70 (25%), Positives = 27/70 (38%), Gaps = 4/70 (5%) Frame = +1 Query: 451 IACDMCGRGYHAKCHS---PPVDAWINGAS-WHCKRCVDQRYRVAAAENRALKRSDLFRF 618 + CD C HAKC P ++ N + W C +C + L+ S+ F F Sbjct: 94 LQCDSCNIWNHAKCMDISIPSYESLANSSCLWLCPKCDASNFSETLLSASTLELSNSFNF 153 Query: 619 KGGQPTKATA 648 Q + A Sbjct: 154 LPSQTSSPVA 163 >SB_58672| Best HMM Match : PHD (HMM E-Value=3e-18) Length = 458 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 13/47 (27%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSP--PV------DAWINGASW-----HCKRC 549 ++ CD C RGYH C P PV D W A W HC C Sbjct: 216 LLMCDKCQRGYHVDCLGPSYPVVPEGSEDTWDPEAVWMHEFTHCYDC 262 >SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) Length = 1061 Score = 30.3 bits (65), Expect = 1.6 Identities = 24/101 (23%), Positives = 38/101 (37%), Gaps = 4/101 (3%) Frame = +1 Query: 358 LSVPPADDGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHS---PPVDAWINGA 528 +S+ P + C +CK+ P + CD C HAKC P ++ N + Sbjct: 154 ISLNPGPAWKYPCGLCKK---PVKSNQRG--LQCDSCNIWNHAKCMDISIPSYESLANSS 208 Query: 529 S-WHCKRCVDQRYRVAAAENRALKRSDLFRFKGGQPTKATA 648 W C +C + L+ S+ F F Q + A Sbjct: 209 CLWLCPKCDASNFSETLLSASTLELSNSFIFLPSQTSSPVA 249 >SB_9857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1125 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 448 IIACDMCGRGYHAKCHSPPVDAWINGASWHCKRC 549 +I CD C R +H +C D ++ + W C C Sbjct: 494 VILCDFCPRVFHKRCVR---DGAMSASKWRCPSC 524 >SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = +1 Query: 451 IACDMCGRGYHAKCHSPPVDAW--INGA--SWHCKRC 549 + CD C + YH +C P + +N + SW C C Sbjct: 107 VQCDSCDKWYHVRCMDTPTKVYQGLNNSYTSWICCTC 143 >SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1805 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 4 DIKAEVSKQLSLIDELLRDLDKTITPCASK-KNEKKEEETQDAMPDSTTSTEKNNANP 174 D +++SK+ ++E L +LD+ + K K K++ QDAM KN P Sbjct: 1023 DTNSKISKEKKTLEEKLNELDQALIDEEEKSKGLAKQKAKQDAMIADLEERLKNEERP 1080 >SB_9001| Best HMM Match : PHD (HMM E-Value=0.00096) Length = 345 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/70 (25%), Positives = 27/70 (38%), Gaps = 4/70 (5%) Frame = +1 Query: 451 IACDMCGRGYHAKCHS---PPVDAWINGAS-WHCKRCVDQRYRVAAAENRALKRSDLFRF 618 + CD C HAKC P ++ N + W C +C + L+ S+ F F Sbjct: 112 LQCDSCNIWNHAKCMDISIPSYESLANSSCLWLCPKCDAYNFSETLLSASTLELSNSFNF 171 Query: 619 KGGQPTKATA 648 Q + A Sbjct: 172 LPSQTSSPVA 181 >SB_6668| Best HMM Match : PHD (HMM E-Value=0.00096) Length = 210 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/70 (25%), Positives = 27/70 (38%), Gaps = 4/70 (5%) Frame = +1 Query: 451 IACDMCGRGYHAKCHS---PPVDAWINGAS-WHCKRCVDQRYRVAAAENRALKRSDLFRF 618 + CD C HAKC P ++ N + W C +C + L+ S+ F F Sbjct: 112 LQCDSCNIWNHAKCMDISIPSYESLANSSCLWLCPKCDAYNFSETLLSASTLELSNSFNF 171 Query: 619 KGGQPTKATA 648 Q + A Sbjct: 172 LPSQTSSPVA 181 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 29.5 bits (63), Expect = 2.8 Identities = 24/94 (25%), Positives = 45/94 (47%) Frame = +1 Query: 10 KAEVSKQLSLIDELLRDLDKTITPCASKKNEKKEEETQDAMPDSTTSTEKNNANPFHCGD 189 + ++ Q S+ID + D + + ++NEK EEE +D D +++ + + Sbjct: 1241 RVDMGLQTSIIDTSVVDEVSSQLSMSRQRNEKLEEELKDTKED--VQRRRSDMSALKRAN 1298 Query: 190 DVLVANKDGRYYLGTIIELSTSNDNDLCEVGASV 291 DVL+ ++ YL T E + N+L E A + Sbjct: 1299 DVLI-KQNQTLYLET--ESLKATINELSEKSAQL 1329 >SB_44702| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.03) Length = 307 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 7 IKAEVSKQLSLIDELLRDLDKTITPCASKKNEKKEEETQD 126 ++AE KQ+SLI +L D+ K+I + EK E+ET D Sbjct: 122 LQAESRKQISLISKLKSDI-KSIKEQHDTEVEKLEKETSD 160 >SB_17974| Best HMM Match : PAN (HMM E-Value=0.004) Length = 318 Score = 29.1 bits (62), Expect = 3.7 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 453 RVRHVWQRLPRQMSLA-PRRCL-DQWCIMAL*KVC*PKIQSSSSRKPGIETL 602 R RH +RL Q ++ +RCL WCI +V P+ + G+ETL Sbjct: 44 RSRHAKKRLQAQSQISCSQRCLQQDWCISVNYEVSRPEAGACELNTYGVETL 95 >SB_33862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = +1 Query: 355 LLSVPPADDGRIMCVVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPPVDAWING 525 +L+VP + C+ C+ EG A + C+ G+ +C+ VD W G Sbjct: 12 MLTVPLVSG--LSCIQCQNTEGFGMCMKYRAFVECE----GWQDRCYKASVDTWYEG 62 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/68 (25%), Positives = 33/68 (48%) Frame = +1 Query: 208 KDGRYYLGTIIELSTSNDNDLCEVGASVARCLVKFGDGTHSWAPVSSLKLLSVPPADDGR 387 + G++YLG ++++ N + R VKF DG +W ++ ++ + P + Sbjct: 260 RSGKHYLGRVVQVDYMNPH--------YPRYYVKFDDGDETWCNLNEIRPV---PLSRNQ 308 Query: 388 IMCVVCKR 411 + CVV R Sbjct: 309 VGCVVWGR 316 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 453 RVRHVWQRLPRQMSLA-PRRCLDQ-WCIMAL*KVC*PKIQSSSSRKPGIETL 602 R RHV +RL Q ++ RC Q WCI +V P+ + G+ETL Sbjct: 97 RSRHVKKRLQGQSQISCSLRCQQQDWCISVNYEVSRPEAGACELNTYGVETL 148 >SB_17329| Best HMM Match : S-antigen (HMM E-Value=0.31) Length = 646 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +1 Query: 394 CVVCKRREGPATGPATNAIIACDMCGRGYHAKCHSPP 504 C C TGP T CD CG+ +C S P Sbjct: 143 CTACGTHCKKTTGPCTACRDVCDRCGKA-RWRCESQP 178 >SB_14079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 546 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 453 RVRHVWQRLPRQMSLA-PRRCLDQ-WCIMAL*KVC*PKIQSSSSRKPGIETL 602 R RHV +RL Q ++ RC Q WCI +V P+ + G+ETL Sbjct: 44 RSRHVKKRLQGQSQISCSLRCQQQDWCISVNYEVSRPEAGACELNTYGVETL 95 >SB_59382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 58 DLDKTITPCASKKNEKKEEETQDAMPDSTTSTEKNN 165 DL K I+ ASK++ K+ Q MPD T EK++ Sbjct: 44 DLHKRIS-AASKRSTKRPHRPQQKMPDLATVQEKSS 78 >SB_55139| Best HMM Match : PAN (HMM E-Value=0.055) Length = 139 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 453 RVRHVWQRLPRQMSLA-PRRCLDQ-WCIMAL*KVC*PKIQSSSSRKPGIETL 602 R RHV +RL Q ++ RC Q WCI +V P+ + G+ETL Sbjct: 22 RSRHVRKRLQGQSQISCSLRCQQQDWCISVNYEVSRPEAGACELNTYGVETL 73 >SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) Length = 690 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 395 AWCASDARGLPLDRPPTL-SSRATCVAEATTPNVTRPPSMPG 517 AW ++A D PP+ SS A +A T TRP + PG Sbjct: 152 AWSVNEADVSESDAPPSRPSSAAALYRQALTKQRTRPATAPG 193 >SB_20264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 453 RVRHVWQRLPRQMSLA-PRRCLDQ-WCIMAL*KVC*PKIQSSSSRKPGIETL 602 R RHV +RL Q ++ RC Q WCI +V P+ + G+ETL Sbjct: 55 RSRHVKKRLQGQSQISCSLRCQQQDWCISVNFEVSRPEAGACELNTYGVETL 106 >SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) Length = 895 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = +1 Query: 451 IACDMCGRGYHAKCHSPPVDAW-----INGASWHCKRCV 552 I CD C YH KC + ++ ++ +W C +C+ Sbjct: 121 IQCDECDMWYHTKCIAMTAQSYDRLGSVSQLAWLCNKCL 159 >SB_14778| Best HMM Match : MH1 (HMM E-Value=2.8026e-45) Length = 1133 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +1 Query: 76 TPCASKKNEKKEEETQDAMPDSTTS 150 TPC+S+KN + ++D++P+ T S Sbjct: 1074 TPCSSRKNSVESLLSEDSIPEETPS 1098 >SB_3140| Best HMM Match : C1_3 (HMM E-Value=7) Length = 340 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -3 Query: 259 HYSYLTLLLFLNNIFHPYWPQVHHLRSGMG*HC-FSRC*LLSLALHPV 119 H ++ LF I+ + + H HC F+RC L +L +HPV Sbjct: 24 HCAFTRCTLFALRIYPVHTLCIAHSPGAHSLHCAFTRCTLFALRIHPV 71 >SB_20744| Best HMM Match : CH (HMM E-Value=0.92) Length = 1103 Score = 28.3 bits (60), Expect = 6.5 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Frame = -1 Query: 567 SVSLVNTPFTMP*CTIDPGIDGGRV-TFGV---VASATHVARDDSVGGRSSGRPLASLAH 400 +++ + + F +DP DGG + T GV V A S G SSGR L H Sbjct: 436 TLTSIESSFQQQISPLDPQRDGGTLDTLGVRPRVELPQENASQSSSEGGSSGRSTPVLHH 495 Query: 399 HAH 391 H H Sbjct: 496 HYH 498 >SB_2877| Best HMM Match : Hom_end (HMM E-Value=1.1) Length = 1250 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 319 GTHSWAPVSSLKLLSVPPADDGRIMCVVCKRREGPATGPATNA 447 G H+ A + + +VP A G C +R GPA+ P +A Sbjct: 299 GAHNMAGATRDQPRAVPAAKQGFRPCESARRGRGPASSPRAHA 341 >SB_58276| Best HMM Match : MIB_HERC2 (HMM E-Value=8.3e-33) Length = 2822 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/66 (24%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Frame = +1 Query: 79 PCASKKNEKKEEETQDAMPDSTT---STEKNNANPFHCGDDVLVANKDGRYYLGTIIELS 249 P E++ ++T+ D T ++E A P+H D +V N+D Y + Sbjct: 643 PIKEITQEEEPQKTRSDKDDDTVQEDASELEQAKPYHWNDWCIVRNRDCLYMWNESCAIE 702 Query: 250 TSNDND 267 SN ++ Sbjct: 703 LSNGSN 708 >SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 27.9 bits (59), Expect = 8.5 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 3/76 (3%) Frame = +2 Query: 254 VMTTTCVRWAQA---WPDA*SSSATARTHGRQXXXXXXXXXXPPMTVASCAWCASDARGL 424 V TT C W ++ W A S+SAT + PP ++ SC L Sbjct: 561 VATTPCSSWTRSVFSWMTA-STSATDPIASSKPLRFATSRRMPPSSLNSC---------L 610 Query: 425 PLDRPPTLSSRATCVA 472 LD+PP L TC++ Sbjct: 611 GLDQPPHLPRLRTCIS 626 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,866,638 Number of Sequences: 59808 Number of extensions: 483687 Number of successful extensions: 1803 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 1652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1799 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -