BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0853 (674 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A3MTJ7 Cluster: FAD dependent oxidoreductase; n=1; Pyro... 33 8.4 >UniRef50_A3MTJ7 Cluster: FAD dependent oxidoreductase; n=1; Pyrobaculum calidifontis JCM 11548|Rep: FAD dependent oxidoreductase - Pyrobaculum calidifontis (strain JCM 11548 / VA1) Length = 339 Score = 32.7 bits (71), Expect = 8.4 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 291 AVLQRYYYLPINRLYDRVLR*LTFATRYGLKKYE 392 AVL R Y +P+ ++ +R+ R L FA+ YG K E Sbjct: 104 AVLTRDYLIPVRKVVNRLRRELGFASSYGFLKVE 137 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 479,802,201 Number of Sequences: 1657284 Number of extensions: 7295963 Number of successful extensions: 13723 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 13486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13722 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52066120554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -