BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0853 (674 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 27 2.5 SPBC646.12c |gap1|src1, sar1|GTPase activating protein Gap1|Schi... 26 5.7 SPBC18H10.02 |lcf1||long-chain-fatty-acid-CoA ligase Lcf1 |Schiz... 25 10.0 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 27.1 bits (57), Expect = 2.5 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 290 WSIIFFKRDYFCYFTTAMLVVTDQLFLINLSIF 192 W ++F +FCYF T+ +V +D FL + S F Sbjct: 8 WIRLYFTFRFFCYFLTS-VVASDVSFLGDFSGF 39 >SPBC646.12c |gap1|src1, sar1|GTPase activating protein Gap1|Schizosaccharomyces pombe|chr 2|||Manual Length = 766 Score = 25.8 bits (54), Expect = 5.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 375 RNVSRRLINAILDRTVC*LVG 313 RN++ RL +I D T+C L+G Sbjct: 314 RNLTNRLFPSISDSTICSLIG 334 >SPBC18H10.02 |lcf1||long-chain-fatty-acid-CoA ligase Lcf1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 25.0 bits (52), Expect = 10.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 297 LQRYYYLPINRLYDRVLR*LTFATRYGLKK 386 L Y YL N +YD+ LR + GL K Sbjct: 91 LSDYNYLSFNDIYDKALRYAGALRKLGLNK 120 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,047,287 Number of Sequences: 5004 Number of extensions: 31255 Number of successful extensions: 51 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -