BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0848 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 25 0.92 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.6 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 2.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.8 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 3.7 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 3.7 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 4.9 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 4.9 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.6 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.6 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 24.6 bits (51), Expect = 0.92 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 32 REIHCK*WVLLLKLSVQGDESTYPKSGQTVVVHYTGTLTNG 154 RE+ + W ++K S+ T G T V+H G L+ G Sbjct: 283 RELTIQIWQQIVKFSLNSILKTVVAYGGTSVMHQRGKLSAG 323 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 260 GERAKLTCSPDYAYGQQGHPGVIPPNST 343 GER L S DY Y +G G +ST Sbjct: 1579 GERVMLKASEDYRYSVRGLCGNFDHDST 1606 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 197 FRIGKSEVIRGWDEGVAKMSVGERAKLTCSP 289 FRI E R W K+ + + KL C P Sbjct: 249 FRIQVDECDRLWILDSGKVDIAKGGKLACPP 279 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 2.8 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = -2 Query: 384 CIYSRRRSSTSKISVELGGMTPGWPC*P*A*SGEQVNLARSPTDIFATPSSQPRITSDFP 205 C R+ S S +E G P P + + +PT + ++P S+ + D P Sbjct: 568 CPRFRKLDSPSDSGIESGTEKPDKPA--------SSSASSAPTSVCSSPRSEDKEVEDMP 619 Query: 204 IL 199 +L Sbjct: 620 VL 621 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 58 VTVETISPGRRVDLPQIR 111 +T+ TIS R DLP++R Sbjct: 285 LTLSTISLDSRTDLPKVR 302 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 670 NYNDKMLLRNVSVVR*NRIDDLQNFI 593 NYND +RN +V + +D Q ++ Sbjct: 160 NYNDPSNVRNCELVGLHDLDQSQEYV 185 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/26 (26%), Positives = 18/26 (69%) Frame = -2 Query: 681 YCDEITMTKCS*GM*VLSDKIESMIF 604 +C+++++ + + M VLSD + ++F Sbjct: 347 FCNDLSIDRSTNTMYVLSDNFQQLLF 372 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 664 NDKMLLRNVSVVR*NRIDDLQN 599 N K L+RN V N+ D++QN Sbjct: 404 NVKELIRNTHCVNNNQNDNIQN 425 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +2 Query: 116 TVVVHYTGTLTNGKKFDSSRDRGKPFKFRI 205 T + T+ NG + R+ KPF +I Sbjct: 461 TYFEQFDTTINNGLLLEEQRNDDKPFLIKI 490 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +2 Query: 116 TVVVHYTGTLTNGKKFDSSRDRGKPFKFRI 205 T + T+ NG + R+ KPF +I Sbjct: 461 TYFEQFDTTINNGLLLEEQRNDDKPFLIKI 490 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,051 Number of Sequences: 438 Number of extensions: 4328 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -