BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0845 (650 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 44 0.004 UniRef50_Q8IWK6 Cluster: Probable G-protein coupled receptor 125... 35 1.9 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 43.6 bits (98), Expect = 0.004 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = +2 Query: 227 FLLLSWVDELTVHLVLSGYLSP 292 FLLL WVDELT HLVLSGY SP Sbjct: 154 FLLLRWVDELTAHLVLSGYWSP 175 >UniRef50_Q8IWK6 Cluster: Probable G-protein coupled receptor 125 precursor; n=39; Euteleostomi|Rep: Probable G-protein coupled receptor 125 precursor - Homo sapiens (Human) Length = 1321 Score = 34.7 bits (76), Expect = 1.9 Identities = 16/41 (39%), Positives = 27/41 (65%) Frame = +3 Query: 489 LLSYFWHDAVIHSNLNGVQPL*VRLCFYISMRVLVFMGGIS 611 ++SY +H ++I +L L V LCF+I + +VF+GGI+ Sbjct: 778 IVSYIYHHSLIRISLKSWHML-VNLCFHIFLTCVVFVGGIT 817 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 625,676,145 Number of Sequences: 1657284 Number of extensions: 12270170 Number of successful extensions: 24224 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24224 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 48760335122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -