BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0845 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1 |Sc... 27 3.1 SPAC227.04 |||autophagy C terminal domain family protein|Schizos... 26 5.4 SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch... 25 7.2 SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 25 7.2 SPBC6B1.05c |||ubiquitin-like conjugating enzyme|Schizosaccharom... 25 9.5 >SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1573 Score = 26.6 bits (56), Expect = 3.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 573 YKSIASLITAAHHLNSNVSLHRARNRIT 490 Y + L+ A++LN N+ L R RIT Sbjct: 1206 YADVIKLVGMANNLNDNLELEEFRTRIT 1233 >SPAC227.04 |||autophagy C terminal domain family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 179 Score = 25.8 bits (54), Expect = 5.4 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -2 Query: 472 LTLVGPLVSPHEWVPLTPPISAVKKFFF 389 L+L+ P+++ H W+ +P V +FFF Sbjct: 56 LSLMNPMITMHAWIRDSPSFE-VPQFFF 82 >SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1480 Score = 25.4 bits (53), Expect = 7.2 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = -1 Query: 176 HFCYLKTLKWMHSVCESCHKTETGIELMMGKN*IKIY 66 H Y K L + +C C K + ++ N K+Y Sbjct: 1418 HNAYNKKLSLLFDICRGCSKLSSSDPVLCKSNSCKVY 1454 >SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 308 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 253 AHSPPSVKWLLEPIDIYNVNAPPILR 330 A PPS+K P+DI N++A L+ Sbjct: 224 ASQPPSIKTDASPVDIKNMDAAEKLK 249 >SPBC6B1.05c |||ubiquitin-like conjugating enzyme|Schizosaccharomyces pombe|chr 2|||Manual Length = 649 Score = 25.0 bits (52), Expect = 9.5 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +2 Query: 515 SDTFEFKWCAAVISEAM-LLYINAGIG 592 +DT E +W VIS AM L IN+ +G Sbjct: 452 TDTRESRWLPTVISTAMDKLLINSALG 478 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,632,387 Number of Sequences: 5004 Number of extensions: 53893 Number of successful extensions: 117 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -