BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0845 (650 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC035645-1|AAH35645.1| 1266|Homo sapiens Similar to RIKEN cDNA 3... 35 0.29 AY181243-1|AAO27355.1| 1178|Homo sapiens G protein-coupled recep... 35 0.29 >BC035645-1|AAH35645.1| 1266|Homo sapiens Similar to RIKEN cDNA 3830613O22 gene protein. Length = 1266 Score = 34.7 bits (76), Expect = 0.29 Identities = 16/41 (39%), Positives = 27/41 (65%) Frame = +3 Query: 489 LLSYFWHDAVIHSNLNGVQPL*VRLCFYISMRVLVFMGGIS 611 ++SY +H ++I +L L V LCF+I + +VF+GGI+ Sbjct: 778 IVSYIYHHSLIRISLKSWHML-VNLCFHIFLTCVVFVGGIT 817 >AY181243-1|AAO27355.1| 1178|Homo sapiens G protein-coupled receptor 125 protein. Length = 1178 Score = 34.7 bits (76), Expect = 0.29 Identities = 16/41 (39%), Positives = 27/41 (65%) Frame = +3 Query: 489 LLSYFWHDAVIHSNLNGVQPL*VRLCFYISMRVLVFMGGIS 611 ++SY +H ++I +L L V LCF+I + +VF+GGI+ Sbjct: 635 IVSYIYHHSLIRISLKSWHML-VNLCFHIFLTCVVFVGGIT 674 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,962,358 Number of Sequences: 237096 Number of extensions: 2003464 Number of successful extensions: 2669 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2669 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7253890590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -