BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0839 (695 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 7.3 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 9.6 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 9.6 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.4 bits (43), Expect = 7.3 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +2 Query: 2 QQSSQSQPHLPA----VHPADQRTRLWQPSPSPSVLSYPNSTISY 124 ++S Q Q + P H ++ + + PSPS S L+Y + S+ Sbjct: 240 KESPQMQSYRPTGNITPHGSNTSSLITTPSPSASPLAYQHEYNSF 284 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = +2 Query: 458 WSYLHFGMFSTKVLFFTFSTCCVKMF 535 W + M VL FT+++ C++++ Sbjct: 206 WYSISVFMVPLVVLIFTYTSICIEIW 231 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/34 (29%), Positives = 14/34 (41%) Frame = +1 Query: 13 PKPTSPARGAPCRPTNEALATFPFPFCSLLPKFN 114 P P +P P +A P+P S+ P N Sbjct: 324 PSPVPGHSTSPNLPLTHNIAHNPYPSHSIYPSSN 357 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,804 Number of Sequences: 336 Number of extensions: 3533 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -