BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0838 (744 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29B12.02c |set2||histone lysine methyltransferase Set2 |Schi... 28 1.6 SPBC1105.18c ||SPBC887.21c|peptide release factor|Schizosaccharo... 27 2.1 SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam... 26 6.5 SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21... 26 6.5 SPBC11G11.01 |fis1||mitochondrial fission protein Fis1 |Schizosa... 25 8.6 SPBC18H10.10c |cwc16||complexed with Cdc5 protein Cwf16|Schizosa... 25 8.6 >SPAC29B12.02c |set2||histone lysine methyltransferase Set2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 798 Score = 27.9 bits (59), Expect = 1.6 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 131 IQSHSKINHIKLTVSGQDASTCFHLDAVSPAS 226 ++ H+K H K T S QDA+ HL + SP S Sbjct: 665 LKRHAKKLHEKKTKSSQDATIDHHLTSHSPES 696 >SPBC1105.18c ||SPBC887.21c|peptide release factor|Schizosaccharomyces pombe|chr 2|||Manual Length = 162 Score = 27.5 bits (58), Expect = 2.1 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -1 Query: 378 AFYCGAILRARHVNFCVDLKTKRTLNCLSQSDFLETLI 265 AF C A L RH +C +T L L + D ET I Sbjct: 20 AFSCLAELNFRHTWYCSKKETPYQLERLQEEDIEETFI 57 >SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 25.8 bits (54), Expect = 6.5 Identities = 16/63 (25%), Positives = 27/63 (42%) Frame = +2 Query: 500 NRAALCIELIDRARPQRDAVLLLCHSHFTATRPSDSTYPSHKHAVPIATSWTTSMSKIDQ 679 N + E +DR + + V L C FT+T S+ S P T+ ++ +S + Sbjct: 102 NPTSTVTEYVDRVQTVTEYVTLSCGQAFTSTVDISSSTSSSVINSPTGTAVSSQISTLSM 161 Query: 680 DAS 688 S Sbjct: 162 SPS 164 >SPCC16A11.17 |cdc21|mcm4, SPCC24B10.01|MCM complex subunit Cdc21|Schizosaccharomyces pombe|chr 3|||Manual Length = 911 Score = 25.8 bits (54), Expect = 6.5 Identities = 28/109 (25%), Positives = 44/109 (40%) Frame = +2 Query: 365 PQ*KAARQLRRRHDALVNARRDSTECASRRGDEKDAGE*RSPPQRNRAALCIELIDRARP 544 PQ + L +R+D +++ T ++RRGD + + S P R R +D RP Sbjct: 72 PQSSRSHLLSQRNDLFLDSSSQRTPRSTRRGDIHSSVQ-MSTPSRRRE------VDPQRP 124 Query: 545 QRDAVLLLCHSHFTATRPSDSTYPSHKHAVPIATSWTTSMSKIDQDASF 691 L S A S + S + W T++S + ASF Sbjct: 125 GVSTPSSLLFSGSDALTFSQAHPSSEVADDTVRVIWGTNVSIQESIASF 173 >SPBC11G11.01 |fis1||mitochondrial fission protein Fis1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 160 Score = 25.4 bits (53), Expect = 8.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 165 SLIWFILECDWISDVEQPVSLYCACY 88 +L W ++ D V+Q +SL+C+ Y Sbjct: 45 NLAWALVRSDSTQHVQQGLSLFCSIY 70 >SPBC18H10.10c |cwc16||complexed with Cdc5 protein Cwf16|Schizosaccharomyces pombe|chr 2|||Manual Length = 294 Score = 25.4 bits (53), Expect = 8.6 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +2 Query: 404 DALVNARRDSTECASRRGDEKDAGE*RSPPQRNRAALCIELIDRARPQRDAVLLL 568 D V+++R + R+ EK E + +NRAAL I+++ + +D LLL Sbjct: 152 DPFVSSQRLRKQFRERKKIEKKQ-EAKDLSLKNRAALDIDILPPSSSDKDKALLL 205 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,657,965 Number of Sequences: 5004 Number of extensions: 50342 Number of successful extensions: 108 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -