BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0837 (497 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 25 0.50 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 22 2.7 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 6.2 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 24.6 bits (51), Expect = 0.50 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 205 FNSQWLVRDLRGKSERNFKAYVSLFMRHLCEPGAD-NAETF 324 +NS+ RD +GK + NF F HL A NAETF Sbjct: 25 YNSKAYFRDGQGKFDVNFIDPALQFCTHLIYGYAGINAETF 65 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 22.2 bits (45), Expect = 2.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 378 DSCQNVLTG*SF 343 DSC N+LTG F Sbjct: 390 DSCSNILTGDQF 401 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +2 Query: 254 TSRPTCPCSCAISANRAPTTRKHLR 328 T R TC C A R HLR Sbjct: 286 TGRATCDCPNCQEAERLGPAGVHLR 310 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,804 Number of Sequences: 336 Number of extensions: 2205 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -