BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0837 (497 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25170.1 68415.m03010 chromatin remodeling factor CHD3 (PICKL... 76 2e-14 At4g31900.1 68417.m04533 chromatin remodeling factor, putative s... 58 3e-09 At4g35900.1 68417.m05099 DNA-binding protein-related weak simila... 29 2.3 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 28 3.0 At1g05070.1 68414.m00509 expressed protein 27 5.3 At2g40070.1 68415.m04923 expressed protein 27 7.0 At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-conta... 27 7.0 At5g49170.1 68418.m06086 expressed protein similar to unknown pr... 27 9.3 At5g25600.1 68418.m03046 hypothetical protein low similarity to ... 27 9.3 At5g22980.1 68418.m02686 serine carboxypeptidase III, putative s... 27 9.3 At2g34590.1 68415.m04250 transketolase family protein similar to... 27 9.3 >At2g25170.1 68415.m03010 chromatin remodeling factor CHD3 (PICKLE) identical to chromatin remodeling factor CHD3 [Arabidopsis thaliana] GI:6478518 Length = 1384 Score = 75.8 bits (178), Expect = 2e-14 Identities = 44/117 (37%), Positives = 64/117 (54%), Gaps = 2/117 (1%) Frame = +1 Query: 112 GGNMEVLGFNARQRKSFLNAIMRYGMPPQDAFNSQW--LVRDLRGKSERNFKAYVSLFMR 285 G + VLGFN QR F+ +MRYG A N W V L+ K+ Y LF++ Sbjct: 945 GRSFRVLGFNQSQRAIFVQTLMRYG-----AGNFDWKEFVPRLKQKTFEEINEYGILFLK 999 Query: 286 HLCEPGADNAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHINGYYSMPELV 456 H+ E +N+ TF+DGVP+EGL + VL RI ++ L+++KV+ E G P + Sbjct: 1000 HIAEEIDENSPTFSDGVPKEGLRIEDVLVRIALLILVQEKVKFVEDHPGKPVFPSRI 1056 >At4g31900.1 68417.m04533 chromatin remodeling factor, putative strong similarity to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1202 Score = 58.0 bits (134), Expect = 3e-09 Identities = 39/110 (35%), Positives = 53/110 (48%), Gaps = 10/110 (9%) Frame = +1 Query: 112 GGNMEVLGFNARQRKSFLNAIMRYGMPPQDAFNSQW--LVRDLRGKSERNFKAYVSLFMR 285 G + VLGFN +R FL RYG A N W V L K+ Y LF++ Sbjct: 881 GRYLMVLGFNETERDIFLRTFKRYG-----AGNFDWKEFVNPLYMKTYDEINKYGILFLK 935 Query: 286 HLCEPGADNAETF--------ADGVPREGLSRQHVLTRIGVMSLIRKKVQ 411 H+ E DN+ F ADGVP+EG+S +L + M L+++K Q Sbjct: 936 HIAENPTDNSTNFKVITAMVYADGVPKEGISSDELLVSMTFMMLVKEKCQ 985 >At4g35900.1 68417.m05099 DNA-binding protein-related weak similarity to DNA-binding factor gmlip15 [Zea mays] GI:14289167 Length = 245 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 348 IIPSARFDTNRGNEFDQEKGSGIRTHQRVLQH 443 ++PS+ F RG D +GSG R H+R++++ Sbjct: 195 LVPSSSFGKKRGQ--DSNEGSGNRRHKRMIKN 224 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +3 Query: 186 DAAAGRFQLAVVSERSAREV*AQLQGLRVLVHAPSLRTGRRQRGN 320 + A GRF+ AVV+ A ++ Q + +L L T R RGN Sbjct: 460 ELALGRFENAVVTAEKASKIDPQNNEVEILYKNVRLITRARDRGN 504 >At1g05070.1 68414.m00509 expressed protein Length = 184 Score = 27.5 bits (58), Expect = 5.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 242 SLSATSRPTCPCSCAISANRAPTTRKHLRTA 334 ++SA+S P+CPC C S A T K L A Sbjct: 38 AVSASSCPSCPCEC--STYSAVTIPKELSNA 66 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 236 AGSLSATSRPTCPCSCAISANRAPTTR 316 A S + TSRPT P S IS + PT R Sbjct: 293 ARSSTPTSRPTLPPSKTISRSSTPTRR 319 >At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226: DnaJ domain Length = 2554 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +1 Query: 268 VSLFMRHLCEPGADNAETFADGVPREGLSRQHVLTRIGVMSLIRKKV 408 +++ MR + E A AE+ D R+G +H+L + + R++V Sbjct: 663 IAVIMRTIAEEDAIAAESMRDAALRDGALLRHLLNAFSLPASERREV 709 >At5g49170.1 68418.m06086 expressed protein similar to unknown protein (gb|AAF63814.1) Length = 185 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 112 RLWPVMEAAVGRVPLAFRGDAYSGD*ADLHY 20 R WP+ A VGR GD D +D+H+ Sbjct: 88 RKWPISSAVVGRCSGENDGDNEFDDRSDVHF 118 >At5g25600.1 68418.m03046 hypothetical protein low similarity to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 331 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/56 (26%), Positives = 23/56 (41%) Frame = -1 Query: 287 WRMNKDT*ALKLRSDFPRRSLTNHCELKASCGGIPYRMIALRNDFLCLALKPRTSM 120 W N+ L+ DFPR + +L GIP + + F+ L P T + Sbjct: 97 WLFNQWFVPLQRWEDFPRADFLTYIDLWVQVRGIPLYVSTMTVRFIASTLGPVTGL 152 >At5g22980.1 68418.m02686 serine carboxypeptidase III, putative similar to serine carboxypeptidase III from Oryza sativa SP|P37891, Matricaria chamomilla GI:6960455, Hordeum vulgare SP|P21529, Triticum aestivum SP|P11515; contains Pfam profile PF0450 serine carboxypeptidase Length = 505 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 406 VQEFEHINGYYSMP 447 VQEF H GYYS+P Sbjct: 93 VQEFGHYAGYYSLP 106 >At2g34590.1 68415.m04250 transketolase family protein similar to SP|O66113 Pyruvate dehydrogenase E1 component, beta subunit (EC 1.2.4.1). {Zymomonas mobilis}; contains Pfam profiles PF02779: Transketolase, pyridine binding domain, PF02780: Transketolase, C-terminal domain Length = 406 Score = 26.6 bits (56), Expect = 9.3 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +3 Query: 51 ASPRKARGTRPTAASITGQSRRQHGSSRLQRQAEEVIPQCYHAVRDAAA 197 A R + R + G + GSS + R++E +IP D AA Sbjct: 27 APSRSSLSVRSKRYIVAGSDSKSFGSSLVARRSEPLIPNAVTTKADTAA 75 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,662,823 Number of Sequences: 28952 Number of extensions: 218393 Number of successful extensions: 605 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -