BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0833 (629 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 23 2.4 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 5.7 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 7.5 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.9 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 377 GTFAPQTGTKTGKLKTSFTNDTVAVNTNL 463 GT Q TG +F NDTV+ T + Sbjct: 86 GTSESQWEDVTGSTPLTFVNDTVSFTTTV 114 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 154 FKLDLKTKSESGVEFTSGIT 213 F+LDL+ + E+G + +S IT Sbjct: 174 FQLDLQLQDEAGGDISSFIT 193 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/30 (23%), Positives = 16/30 (53%) Frame = -3 Query: 606 HQIGNLEQSCSWRTLLFVYQTGCVHQPSQP 517 H+ + + W ++F+Y C+ + S+P Sbjct: 320 HRNADTHEMSEWVKVVFLYWLPCILRMSRP 349 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 29 GILCEIIPICEFI 67 GI CEI CEF+ Sbjct: 59 GIKCEIYAKCEFL 71 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 514 PGLAWLVYTPSLIHKKQSS 570 PGLA+LVY +++ SS Sbjct: 356 PGLAFLVYPSAVLELPGSS 374 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 514 PGLAWLVYTPSLIHKKQSS 570 PGLA+LVY +++ SS Sbjct: 409 PGLAFLVYPSAVLELPGSS 427 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,703 Number of Sequences: 438 Number of extensions: 3911 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -