BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0812 (719 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14206| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-12) 30 2.2 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 >SB_14206| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-12) Length = 336 Score = 29.9 bits (64), Expect = 2.2 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +3 Query: 465 GSKCVCTLVVKNFSRYVYLLDENKTIF*ITLD-ILVLCLDDIFVALIVTHYIYRFIYFYW 641 G CV LV +F +V TI I +D L L L + ALI T +YR + YW Sbjct: 101 GVYCVARLVAVSFG-WVCAGVSLMTISSIIVDRYLALLLHMRYNALITTSKVYRLVLVYW 159 Query: 642 V 644 + Sbjct: 160 I 160 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 166 RLWDFLRSQEYFFGFLSTNKELFTNLFH 249 RLWD R+ Y+ F++ N +FT +H Sbjct: 403 RLWDMRRTDTYYHQFMAHNGPVFTLDWH 430 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,068,676 Number of Sequences: 59808 Number of extensions: 363816 Number of successful extensions: 685 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -