Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0804
         (721 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8I347 Cluster: Putative uncharacterized protein PFI051...    33   5.4  

>UniRef50_Q8I347 Cluster: Putative uncharacterized protein PFI0510c;
            n=1; Plasmodium falciparum 3D7|Rep: Putative
            uncharacterized protein PFI0510c - Plasmodium falciparum
            (isolate 3D7)
          Length = 1697

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 17/67 (25%), Positives = 30/67 (44%)
 Frame = +3

Query: 78   IYMSVGLPTPVSGALMMRIFVKVRSNNVNFKCPAKRPGTAIYNIVRMTYNFHTHNNCKYI 257
            +Y+ + +    +  L +  F+K  + NVN   P K  G      +      + H NC ++
Sbjct: 1110 LYLRLKIKNLKAKLLHVNFFIKAENENVN---PMKYLGRGRVIRISSKIKLNQHTNCFFV 1166

Query: 258  YLYKVSH 278
            Y +KV H
Sbjct: 1167 YFFKVIH 1173


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 661,837,552
Number of Sequences: 1657284
Number of extensions: 12541837
Number of successful extensions: 20543
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 19908
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20537
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58264468239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)