BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0804 (721 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.2 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4248 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 3/53 (5%) Frame = +1 Query: 529 LFLATLST-INLFNIVTMRLNYESDY*F--SKKTGTYRYITFILAAEKKPISL 678 L+++ L+T INL+ + N E+D SKK G+ +Y ++ L AE P+S+ Sbjct: 3279 LYISNLTTPINLYIPRSPPENLETDENMFVSKKNGSMKYHSYFLRAEDLPVSM 3331 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -2 Query: 513 ILYPHNNNKMTVVSENGLHPTXLSVESKCLCTYTINIIKLDKGL 382 + + NNNK TV +G+ T ++ + +Y + I DKG+ Sbjct: 1416 VAFTVNNNKFTVNDTSGVLYTTHVLDRETKASYQLTITATDKGI 1459 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,572,627 Number of Sequences: 59808 Number of extensions: 397255 Number of successful extensions: 737 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -