BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0803 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 23 2.3 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 23 2.3 AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding prote... 23 3.0 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 9.1 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.1 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 23.4 bits (48), Expect = 2.3 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -1 Query: 492 YFVIFDFFNIFQK 454 YF+++DF +IF+K Sbjct: 385 YFILYDFNDIFEK 397 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 23.4 bits (48), Expect = 2.3 Identities = 7/13 (53%), Positives = 12/13 (92%) Frame = -1 Query: 492 YFVIFDFFNIFQK 454 YF+++DF +IF+K Sbjct: 385 YFILYDFNDIFEK 397 >AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding protein protein. Length = 120 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 181 EELEKDYLETQKVCQKQIKSNQELRKREW-DKFIDDMNFKC 300 EEL+K +KVC K+ + +EL ++ +F D C Sbjct: 4 EELKKTIKNLRKVCSKKNDTPKELLDGQFRGEFPQDERLMC 44 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 70 LKKITEIKDNESERIRKSG 126 L+ I+ +KD+ +E I KSG Sbjct: 184 LESISYVKDDGTEGIAKSG 202 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 259 FFSILGYFLFASGKPFVFQDNL 194 F SIL FL+A G+ + + NL Sbjct: 146 FLSILPIFLYALGEQPLTEQNL 167 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 259 FFSILGYFLFASGKPFVFQDNL 194 F SIL FL+A G+ + + NL Sbjct: 184 FLSILPIFLYALGEQPLTEQNL 205 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,548 Number of Sequences: 438 Number of extensions: 3337 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -