BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0790 (717 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF098501-8|AAC67403.1| 459|Caenorhabditis elegans Hypothetical ... 64 7e-11 Z93395-2|CAB07705.1| 905|Caenorhabditis elegans Hypothetical pr... 30 1.4 Z83112-5|CAB05541.1| 905|Caenorhabditis elegans Hypothetical pr... 30 1.4 >AF098501-8|AAC67403.1| 459|Caenorhabditis elegans Hypothetical protein H28G03.4 protein. Length = 459 Score = 64.5 bits (150), Expect = 7e-11 Identities = 30/60 (50%), Positives = 43/60 (71%) Frame = -1 Query: 717 SPELNPLEYKIWQYLEEKACSKPSSPIWSHSRTSLIKAAADIDMDLVRAAIDDWPRRLKA 538 SP+LNP++Y +W LE KACSKP I S + SL KA ++D++ +RA +D +PRRL+A Sbjct: 341 SPDLNPMDYSVWSVLEAKACSKPHRNIDS-LKDSLKKAWDELDINYLRATVDSFPRRLEA 399 Score = 31.1 bits (67), Expect = 0.82 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = -1 Query: 642 PIWSHSRTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGHFE 508 P+WS K ++++ +RA +D +P+R++ CI+ G FE Sbjct: 411 PVWS-------KVWNELEIPYLRATVDAFPKRVRVCIEADGDIFE 448 >Z93395-2|CAB07705.1| 905|Caenorhabditis elegans Hypothetical protein ZC101.1 protein. Length = 905 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = -3 Query: 313 GSVVSDCNYYKT---RSSESTNTFVTCSEQTYFEQFHK 209 GS ++C Y+K R EST+T T +EQ + Q H+ Sbjct: 608 GSDETECEYFKAAMARRGESTSTSTTTTEQQHQRQHHQ 645 >Z83112-5|CAB05541.1| 905|Caenorhabditis elegans Hypothetical protein ZC101.1 protein. Length = 905 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = -3 Query: 313 GSVVSDCNYYKT---RSSESTNTFVTCSEQTYFEQFHK 209 GS ++C Y+K R EST+T T +EQ + Q H+ Sbjct: 608 GSDETECEYFKAAMARRGESTSTSTTTTEQQHQRQHHQ 645 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,057,961 Number of Sequences: 27780 Number of extensions: 283932 Number of successful extensions: 727 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 727 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -