BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0790 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 25 0.94 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.2 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 5.0 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 6.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 6.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 6.7 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 24.6 bits (51), Expect = 0.94 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 60 SFGGARAAVNNSQPS*LSPCSPTYPGETRKASRPTGP 170 S GG N + ++ SP+YPG + P+ P Sbjct: 60 SSGGVELGWFNDSAAAITSTSPSYPGGGSSSPSPSSP 96 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 2.2 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -1 Query: 579 VRAAIDDWPRRLK 541 + AA+D+WPR L+ Sbjct: 400 ITAAVDEWPRLLR 412 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 2.2 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -1 Query: 579 VRAAIDDWPRRLK 541 + AA+D+WPR L+ Sbjct: 453 ITAAVDEWPRLLR 465 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 178 RFLGPVGLDAFLVSP 134 +FLGPVG VSP Sbjct: 50 QFLGPVGFGGVQVSP 64 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 40 CS*AVWSPSEALGRRL 87 C WSP A+ RRL Sbjct: 196 CLVGTWSPDPAINRRL 211 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 40 CS*AVWSPSEALGRRL 87 C WSP A+ RRL Sbjct: 196 CLVGTWSPDPAINRRL 211 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 40 CS*AVWSPSEALGRRL 87 C WSP A+ RRL Sbjct: 196 CLVGTWSPDPAINRRL 211 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,769 Number of Sequences: 438 Number of extensions: 3598 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -