BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0788 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 27 0.19 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 4.1 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 7.2 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 9.5 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 9.5 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 26.6 bits (56), Expect = 0.19 Identities = 11/50 (22%), Positives = 24/50 (48%) Frame = +2 Query: 440 DSLEEIKKIADNAKKMGLITSLIRGCGPYPDCTKFNNSFGCRTSTERHYR 589 +SL E+ K ++ +K L+ ++ C + C+++ + HYR Sbjct: 106 ESLIEVTKTSETSKLQQLVDNIEHKLSDPNQCVICHRVLSCKSALQMHYR 155 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 4.1 Identities = 14/58 (24%), Positives = 22/58 (37%) Frame = -3 Query: 487 HFLCIVCNFFYFL*RVNFKGHFSLSCHLPGFQTFRVFF*CFLKSSNCCMTALSCYFAF 314 H L ++C + +F + F H C F +F C L + L C + F Sbjct: 159 HLLFLLCIYHFFCAFIIFTMHLLFCCAFIFFNMHLLFLLC-LDYFTLHLLFLPCIYYF 215 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 7.2 Identities = 5/18 (27%), Positives = 13/18 (72%) Frame = +3 Query: 561 VGPAPKDIIDKVTGHLKL 614 + P P+D ++ + GH+++ Sbjct: 218 IPPEPEDYVEDLVGHIEV 235 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 411 VICQAFKPSGSFFSAFSK 358 VIC +PS +S F K Sbjct: 272 VICTIHQPSSEVYSMFDK 289 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 411 VICQAFKPSGSFFSAFSK 358 VIC +PS +S F K Sbjct: 272 VICTIHQPSSEVYSMFDK 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,993 Number of Sequences: 336 Number of extensions: 3342 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -