BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0787 (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 2.6 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 22 4.6 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 22 6.0 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 22 6.0 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 8.0 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 726 NFGGLQDRY*ISHLCYFLLIILFPLMVIFYFD 631 NF G R + + +LL ILF L +F F+ Sbjct: 153 NFSGSWKRARVLVMLAWLLSILFSLPTVFLFE 184 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -3 Query: 661 FSIDGNILF*LLRHHNNQCEM 599 F+ID +LF +L +++ C++ Sbjct: 299 FTIDNKLLFGVLAYYSTTCDI 319 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -3 Query: 688 FMLFFVNYTFSIDGNILF*LLRHHN 614 ++LFFVN+ F + +L L+R+ N Sbjct: 156 YVLFFVNFAFFVVVKML--LVRYRN 178 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -3 Query: 688 FMLFFVNYTFSIDGNILF*LLRHHN 614 ++LFFVN+ F + +L L+R+ N Sbjct: 156 YVLFFVNFAFFVVVKML--LVRYRN 178 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 49 LRSGAAASLNGLRYTQTKRPSKIKSSK 129 L S ++ +L+ +RY PS++ S K Sbjct: 41 LISNSSDALDKIRYESLTNPSRLDSGK 67 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,938 Number of Sequences: 336 Number of extensions: 3544 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -