BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0787 (753 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039044-1|AAG24127.1| 272|Caenorhabditis elegans Hypothetical ... 28 6.2 Z99709-3|CAB54198.1| 231|Caenorhabditis elegans Hypothetical pr... 28 8.2 >AF039044-1|AAG24127.1| 272|Caenorhabditis elegans Hypothetical protein F48G7.13 protein. Length = 272 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 332 LCLRFLKFDDRSKSLFLKNRRLKLITSI 415 +CL+ ++ D +K LF KNR L I I Sbjct: 43 ICLKIQEYSDFNKKLFSKNRELSHIARI 70 >Z99709-3|CAB54198.1| 231|Caenorhabditis elegans Hypothetical protein C47B2.2b protein. Length = 231 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -2 Query: 353 ILKNANTNDIDIIHKIDNLL*IYLTKDLIEVKFTNYTI 240 ILK+ +TN D + D L+ + + + L + FT +T+ Sbjct: 52 ILKDRSTNHSDFVFNADRLMRLVIEECLNHLPFTEHTV 89 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,003,782 Number of Sequences: 27780 Number of extensions: 312995 Number of successful extensions: 775 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 775 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1788025660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -