BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0786 (714 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.9 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 3.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.8 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.9 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -1 Query: 123 TPGQSGSPCDCQ---SPHLPSGCRRRWISPRRYHP 28 TP P + Q H P+G + WI+ RY P Sbjct: 777 TPFDPDVPIELQIQKQSHTPNGIVKTWIAHDRYLP 811 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.6 bits (46), Expect = 3.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +3 Query: 384 HDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDE 491 +D ++VGG V L + N K L PDE Sbjct: 69 YDFIVVGGGAARAVVAGRLSEVSNWKVLLLEAGPDE 104 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 637 VTLPSPLNRLRHSPP 681 +T PSP R R++PP Sbjct: 986 MTDPSPFKRGRYTPP 1000 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,365 Number of Sequences: 438 Number of extensions: 4826 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -