BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0757 (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) 35 0.070 SB_59451| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_11780| Best HMM Match : UPF0058 (HMM E-Value=0.32) 32 0.49 SB_33333| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) 30 2.0 SB_50810| Best HMM Match : DUF1452 (HMM E-Value=4.9) 29 2.6 SB_19556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_7681| Best HMM Match : Annexin (HMM E-Value=0) 29 3.5 SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) 29 4.6 SB_41580| Best HMM Match : CAP_GLY (HMM E-Value=4.1e-28) 29 4.6 SB_20163| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_46990| Best HMM Match : Keratin_B2 (HMM E-Value=4.6) 28 8.0 SB_41916| Best HMM Match : DUF164 (HMM E-Value=0.8) 28 8.0 SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_45529| Best HMM Match : DUF983 (HMM E-Value=0.48) 28 8.0 SB_44603| Best HMM Match : Xan_ur_permease (HMM E-Value=0.00049) 28 8.0 >SB_22720| Best HMM Match : KID (HMM E-Value=0.0014) Length = 847 Score = 34.7 bits (76), Expect = 0.070 Identities = 27/94 (28%), Positives = 48/94 (51%) Frame = +2 Query: 125 DGDVTLCLKEKALRYVETLRSKREITLVDGVTLDSKGSPRSARALEPLPEEPKAREAQVE 304 DG T+ LKEK + ++ L+ K E GV+ S+ S A+ LE L +E + + + Sbjct: 718 DGKRTIALKEKDIE-IQKLQEKLE-----GVSKASEQSKTHAQKLESLNKEQENKLVDAQ 771 Query: 305 SRLVDGVADFLENYVVQFKLPSSAVEGMRRSLDE 406 SRL + A+ + + KL +E + + ++E Sbjct: 772 SRLEESEAEGRKTAHL-LKLKEQKIESLEKKVEE 804 >SB_59451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 31.9 bits (69), Expect = 0.49 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 532 TCQDLTPGRRYHCSEEAAGQQAHRDQLRSGRPSSPRGA 645 T +D+ G H SE G RD++ SG+ S RG+ Sbjct: 186 TAEDIFVGSGNHASERTDGSSTKRDEIPSGKDHSGRGS 223 >SB_11780| Best HMM Match : UPF0058 (HMM E-Value=0.32) Length = 788 Score = 31.9 bits (69), Expect = 0.49 Identities = 17/65 (26%), Positives = 32/65 (49%) Frame = +2 Query: 155 KALRYVETLRSKREITLVDGVTLDSKGSPRSARALEPLPEEPKAREAQVESRLVDGVADF 334 + LR ++L E + + ++ KG+ +A L +P+A E ++ RL G+ Sbjct: 152 RVLRITDSLLHGEEEEMRGWLLVEQKGALGTATVTRSLDTDPQASELVIQVRLAGGIGVS 211 Query: 335 LENYV 349 + NYV Sbjct: 212 VVNYV 216 >SB_33333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +1 Query: 496 GYHRLRSRQSRRTCQDLTPGRRYHCSEEAAGQQAHRDQLRSGR 624 GY ++ R R C L PGR Y + GQ R + +GR Sbjct: 515 GYVWIKKRDFRCRCPKLKPGRSYFIAGNLRGQSRKRSIVLNGR 557 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 30.7 bits (66), Expect = 1.1 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 2/77 (2%) Frame = +1 Query: 442 PSLGHR--QTKDHGPHPPILGYHRLRSRQSRRTCQDLTPGRRYHCSEEAAGQQAHRDQLR 615 P G+R + + H P R RSR RR + +P RR + ++HR + R Sbjct: 202 PRRGYRDQRRRSHSPAHHRRSRSRSRSRSPRRRRRSRSPRRRRRSRSPSPHHRSHRSRSR 261 Query: 616 SGRPSSPRGALRKQRPP 666 S SPR + R P Sbjct: 262 S---RSPRRRHSRSRSP 275 >SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) Length = 264 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/74 (27%), Positives = 27/74 (36%) Frame = +1 Query: 442 PSLGHRQTKDHGPHPPILGYHRLRSRQSRRTCQDLTPGRRYHCSEEAAGQQAHRDQLRSG 621 P HR + H P P + R ++ R + P + E Q+ HR L S Sbjct: 116 PQEPHRPQEPHRPLEPPRPQEQHRPQEPHRPLEPTRPQESHRPLEPPRPQEQHR-PLESH 174 Query: 622 RPSSPRGALRKQRP 663 RP P RP Sbjct: 175 RPLEPTRPQESHRP 188 >SB_50810| Best HMM Match : DUF1452 (HMM E-Value=4.9) Length = 214 Score = 29.5 bits (63), Expect = 2.6 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -1 Query: 192 LLDLKVSTYLKAFS-LRHRVTSPSTHSLTTPRTLPRMFGSESCSAAGIAHATPITIKTT 19 +L L+VS K+ L HR TS +T L++ TLP S S S+ TP +I TT Sbjct: 1 MLILRVSGADKSRDHLNHRHTSTTTSPLSSSSTLPLSSISSSSSSLLSTITTPYSIITT 59 >SB_19556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 29.1 bits (62), Expect = 3.5 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 5/85 (5%) Frame = +1 Query: 427 DQAAPPSLGHRQTKDHGPHPPI---LGYHRLRSRQSRRTC--QDLTPGRRYHCSEEAAGQ 591 D APP+L T++ P PP+ GY + S T Q L+ S E + Sbjct: 70 DPCAPPTLNTEPTRETTPTPPLSFSTGYTTRPAPNSPLTLHEQFLSKTPLPPPSLEVSSH 129 Query: 592 QAHRDQLRSGRPSSPRGALRKQRPP 666 +A ++ L PS + A RPP Sbjct: 130 EAFQETLHRPPPSPVQEAKASPRPP 154 >SB_7681| Best HMM Match : Annexin (HMM E-Value=0) Length = 426 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/70 (28%), Positives = 29/70 (41%) Frame = +1 Query: 418 EEEDQAAPPSLGHRQTKDHGPHPPILGYHRLRSRQSRRTCQDLTPGRRYHCSEEAAGQQA 597 EEE++ P H + ++ G HPP +H R + QDL R GQ Sbjct: 309 EEEERGVHPPEQHHEEEERGVHPP-GEHHEEEERGAHPPGQDLEEEER---GAHPPGQD- 363 Query: 598 HRDQLRSGRP 627 H ++ R P Sbjct: 364 HEEEERGAHP 373 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 418 EEEDQAAPPSLGHRQTKDHGPHPP 489 EEE++ A P H + ++ G HPP Sbjct: 365 EEEERGAHPPEQHHEEEERGVHPP 388 >SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) Length = 166 Score = 28.7 bits (61), Expect = 4.6 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 10/64 (15%) Frame = +1 Query: 505 RLRSRQSRRTCQDLTPGR--RY--------HCSEEAAGQQAHRDQLRSGRPSSPRGALRK 654 +L S S+ +DL GR +Y E+A G Q H + + PSSP G R+ Sbjct: 84 KLHSLMSKENVKDLKSGRSKKYGFVFFKDEEACEKAMGNQPHFIEGQKSGPSSPVGWFRR 143 Query: 655 QRPP 666 PP Sbjct: 144 TPPP 147 >SB_41580| Best HMM Match : CAP_GLY (HMM E-Value=4.1e-28) Length = 834 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -1 Query: 177 VSTYLKAFSLRHRVTSPSTHSLT--TPRTLPRMFGSESCSAA 58 V Y K+ S+RHR T H+ T +PR L F C+A+ Sbjct: 66 VKCYAKSASVRHRPTDRRQHAKTSPSPRKLSTHFTEIRCNAS 107 >SB_20163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +3 Query: 522 KPSYLPRSHSWSPVS 566 K ++LPRSH+W+P+S Sbjct: 105 KETWLPRSHTWTPLS 119 >SB_46990| Best HMM Match : Keratin_B2 (HMM E-Value=4.6) Length = 782 Score = 27.9 bits (59), Expect = 8.0 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 2/84 (2%) Frame = +2 Query: 62 AEQDSDPNILGSVLGVVKECVDGDV-TLCLKEKALRYVETLRSKREITL-VDGVTLDSKG 235 AE ++P + SV G+ E +G++ +LC ++ ALR RE + DG +D Sbjct: 102 AELPTEPPAIASVHGLDFEA-EGELRSLCQEKAALRATSAATKTREAKVREDGAAIDRAF 160 Query: 236 SPRSARALEPLPEEPKAREAQVES 307 + + + LP++ A + E+ Sbjct: 161 TDETGYDPQWLPDDHPAYQEYTEA 184 >SB_41916| Best HMM Match : DUF164 (HMM E-Value=0.8) Length = 391 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 243 GLPGPWSHCPRSPRPGKHRSSLGS 314 GLP P S P S RPG RSS S Sbjct: 275 GLPAPPSPGPGSSRPGSSRSSRSS 298 >SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 418 EEEDQAAPPSLGHRQTKDHGPHPP 489 EEE++ A P H + ++ G HPP Sbjct: 128 EEEERGAHPPGQHHEEEERGAHPP 151 >SB_45529| Best HMM Match : DUF983 (HMM E-Value=0.48) Length = 294 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 11 KCLVVLMVIGVAWAMPAAEQDSDPNILGSVLGVVKECVDGDVT 139 +CL+VL+ GV W++ E N+ G + +V G +T Sbjct: 55 RCLIVLVSYGVLWSITGHEMLPGGNLFGIFIILVCAAFGGFIT 97 >SB_44603| Best HMM Match : Xan_ur_permease (HMM E-Value=0.00049) Length = 453 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 224 DSKGSPRSARALEPLPEEPKAREAQVESRLVDGVAD 331 ++ G+ A +EP+P+E +A+VE +DG D Sbjct: 376 NTDGATNVAIVMEPIPDEKHDGKAEVEGAKLDGKLD 411 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,806,242 Number of Sequences: 59808 Number of extensions: 359863 Number of successful extensions: 1393 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1388 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -