BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0734 (669 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58750-11|AAB00651.2| 256|Caenorhabditis elegans Hypothetical p... 28 5.2 AL161712-1|CAC35913.1| 236|Caenorhabditis elegans Hypothetical ... 28 6.9 >U58750-11|AAB00651.2| 256|Caenorhabditis elegans Hypothetical protein F55G1.1 protein. Length = 256 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 148 WQVQFLAHERHHEGLTSCSKAMKVKHPIT 234 W Q H++HHE +CS M+ +HPI+ Sbjct: 89 WAQQQQQHQQHHEFQPNCSIPMQ-RHPIS 116 >AL161712-1|CAC35913.1| 236|Caenorhabditis elegans Hypothetical protein Y66D12A.1 protein. Length = 236 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 338 VFESCAT*NLRMIFFNNKGG*TSLPDLKLLLINIKRIYECYPLHR 472 V E+ T N++ + G S+P L LL+IN I +PL R Sbjct: 177 VAETVTTENVKCVAAGVIGAMKSVPLLPLLIINFSGIQRLFPLKR 221 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,409,451 Number of Sequences: 27780 Number of extensions: 317228 Number of successful extensions: 550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -