BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0734 (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.5 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 21 8.0 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 21 8.0 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 8.0 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +1 Query: 4 WCKPNLLTPVTSVGSTCQQIFVIFHYVQ*KKVHLKR 111 W +P+ L +T G ++ I H + K + LK+ Sbjct: 228 WLRPDWLFNLTKYGKNQIKLLEIIHGLTKKVIQLKK 263 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 21.4 bits (43), Expect = 8.0 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 Query: 115 WPNLVVGIEVIWQV 156 W N+VV E +W + Sbjct: 156 WDNVVVAYEPVWAI 169 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 187 GLTSCSKAMKVKHPITGAD 243 G SCS + +V P+T +D Sbjct: 45 GNVSCSVSWEVHDPVTNSD 63 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 8.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 320 LRNNLYVFESCAT*NLRMIFFNNKGG*TSLPDLKLL 427 LRN+L+ E+ N+ + F K SL D+K+L Sbjct: 101 LRNDLFECENKEKSNVCLKFEEQKRRKKSLDDVKIL 136 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,130 Number of Sequences: 438 Number of extensions: 4031 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -