BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0723 (372 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY330174-1|AAQ16280.1| 178|Anopheles gambiae odorant-binding pr... 25 1.2 AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-b... 25 1.2 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 24 1.6 AY341201-1|AAR13765.1| 154|Anopheles gambiae NOS protein. 24 2.1 AY341200-1|AAR13764.1| 154|Anopheles gambiae NOS protein. 24 2.1 AY341199-1|AAR13763.1| 154|Anopheles gambiae NOS protein. 24 2.1 AY341198-1|AAR13762.1| 154|Anopheles gambiae NOS protein. 24 2.1 AY341197-1|AAR13761.1| 154|Anopheles gambiae NOS protein. 24 2.1 AY341196-1|AAR13760.1| 154|Anopheles gambiae NOS protein. 24 2.1 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 24 2.1 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 24 2.1 AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 pr... 23 2.8 AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical prote... 23 3.7 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 3.7 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 22 8.5 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 22 8.5 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 22 8.5 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 22 8.5 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 22 8.5 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 22 8.5 >AY330174-1|AAQ16280.1| 178|Anopheles gambiae odorant-binding protein AgamOBP47 protein. Length = 178 Score = 24.6 bits (51), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 110 CFKMADTAHTKIEDNPKI 163 CFKMADT +IE K+ Sbjct: 108 CFKMADTIKDEIEAGAKL 125 >AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-binding protein OBPjj2 protein. Length = 228 Score = 24.6 bits (51), Expect = 1.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 110 CFKMADTAHTKIEDNPKI 163 CFKMADT +IE K+ Sbjct: 158 CFKMADTIKDEIEAGAKL 175 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 176 VLTNSPNAVLSKTLLSRYNDL 238 +L N+P V + LLSR ND+ Sbjct: 500 LLLNNPGKVYERLLLSRINDV 520 >AY341201-1|AAR13765.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 209 KTLLSRYNDLPLPADKILATYI 274 +TLL+R+ D+ P + L TY+ Sbjct: 51 RTLLTRFMDITTPPTRQLLTYL 72 >AY341200-1|AAR13764.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 209 KTLLSRYNDLPLPADKILATYI 274 +TLL+R+ D+ P + L TY+ Sbjct: 51 RTLLTRFMDITTPPTRQLLTYL 72 >AY341199-1|AAR13763.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 209 KTLLSRYNDLPLPADKILATYI 274 +TLL+R+ D+ P + L TY+ Sbjct: 51 RTLLTRFMDITTPPTRQLLTYL 72 >AY341198-1|AAR13762.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 209 KTLLSRYNDLPLPADKILATYI 274 +TLL+R+ D+ P + L TY+ Sbjct: 51 RTLLTRFMDITTPPTRQLLTYL 72 >AY341197-1|AAR13761.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 209 KTLLSRYNDLPLPADKILATYI 274 +TLL+R+ D+ P + L TY+ Sbjct: 51 RTLLTRFMDITTPPTRQLLTYL 72 >AY341196-1|AAR13760.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 209 KTLLSRYNDLPLPADKILATYI 274 +TLL+R+ D+ P + L TY+ Sbjct: 51 RTLLTRFMDITTPPTRQLLTYL 72 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.8 bits (49), Expect = 2.1 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 188 SPNAVLSKTLLSRYNDLPLPADKILATYIWIDGSG 292 +PN LS+ L P P K A +WI G G Sbjct: 246 NPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGG 280 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.8 bits (49), Expect = 2.1 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 188 SPNAVLSKTLLSRYNDLPLPADKILATYIWIDGSG 292 +PN LS+ L P P K A +WI G G Sbjct: 132 NPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGG 166 >AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 262 RHLHLDRRLWRTPEVQR 312 R +H+DR W PEV R Sbjct: 43 RTVHMDRDYWGDPEVFR 59 >AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical protein protein. Length = 104 Score = 23.0 bits (47), Expect = 3.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 198 QCCPKRY 218 QCCPKRY Sbjct: 48 QCCPKRY 54 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 3.7 Identities = 7/15 (46%), Positives = 14/15 (93%) Frame = -2 Query: 86 NVPSMRVLNIARKRI 42 ++PS+++LN+AR +I Sbjct: 533 DLPSLQILNVARNKI 547 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 21.8 bits (44), Expect = 8.5 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 212 TLLSRYNDLPLPADKILATYIWID 283 T + ++DLP P T +W D Sbjct: 235 TTTTTWSDLPPPPPTTTTTTVWTD 258 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 21.8 bits (44), Expect = 8.5 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 212 TLLSRYNDLPLPADKILATYIWID 283 T + ++DLP P T +W D Sbjct: 235 TTTTTWSDLPPPPPTTTTTTVWTD 258 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 21.8 bits (44), Expect = 8.5 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 212 TLLSRYNDLPLPADKILATYIWID 283 T + ++DLP P T +W D Sbjct: 234 TTTTTWSDLPPPPPTTTTTTVWTD 257 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 21.8 bits (44), Expect = 8.5 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 212 TLLSRYNDLPLPADKILATYIWID 283 T + ++DLP P T +W D Sbjct: 234 TTTTTWSDLPPPPPTTTTTTVWTD 257 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 21.8 bits (44), Expect = 8.5 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 212 TLLSRYNDLPLPADKILATYIWID 283 T + ++DLP P T +W D Sbjct: 235 TTTTTWSDLPPPPPTTTTTTVWTD 258 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 21.8 bits (44), Expect = 8.5 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 212 TLLSRYNDLPLPADKILATYIWID 283 T + ++DLP P T +W D Sbjct: 235 TTTTTWSDLPPPPPTTTTTTVWTD 258 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 428,355 Number of Sequences: 2352 Number of extensions: 8955 Number of successful extensions: 27 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 28374390 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -