BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0710 (641 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-13|CAD27764.1| 319|Anopheles gambiae putative transcri... 24 4.7 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 6.2 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 8.2 >AJ439060-13|CAD27764.1| 319|Anopheles gambiae putative transcription factor protein. Length = 319 Score = 23.8 bits (49), Expect = 4.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 194 LDCVAAKIDSMAVPTDARPQQAPALVFTQNSLI 96 + C +A +PTDARP A VFT S++ Sbjct: 33 MGCSSAGSTGTTLPTDARPSFAS--VFTIESIL 63 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 23.4 bits (48), Expect = 6.2 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 83 YLIWKLVVNVCSMPMKFEY 27 Y+I+ L+ N C+ +K+ Y Sbjct: 275 YVIYDLIANECTPKLKYHY 293 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 559 MQCSL*YICVTFFFYLP 509 ++CSL +C FF LP Sbjct: 272 VECSLIAVCARFFLQLP 288 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 711,192 Number of Sequences: 2352 Number of extensions: 14849 Number of successful extensions: 29 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -