BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0710 (641 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41996-1|AAA83471.2| 306|Caenorhabditis elegans Serpentine rece... 30 1.6 Z84574-3|CAB06540.2| 172|Caenorhabditis elegans Hypothetical pr... 27 8.6 >U41996-1|AAA83471.2| 306|Caenorhabditis elegans Serpentine receptor, class sx protein22 protein. Length = 306 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/55 (21%), Positives = 31/55 (56%) Frame = +1 Query: 37 FIGMEHTLTTNFHIKYHTLSINEFCVNTSAGACCGLASVGTAILSIFAATQSSIV 201 FIG++ + +F +KY T+ + ++ + S CC + S+ ++ +F ++ ++ Sbjct: 99 FIGLDRLYSVSFPVKYSTIPVYQYGIVFS---CCCILSLVVSLAKLFYLSEDIVL 150 >Z84574-3|CAB06540.2| 172|Caenorhabditis elegans Hypothetical protein F33E2.4 protein. Length = 172 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 191 DCVAAKIDSMAVPTDARPQQAPALVFTQNSLID 93 DC ID + +P D ++ P LV N D Sbjct: 70 DCTVCNIDDVLLPEDMGMKKVPTLVMKTNDTAD 102 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,489,644 Number of Sequences: 27780 Number of extensions: 320416 Number of successful extensions: 713 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 713 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -