BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0709 (346 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z47087-1|CAA87392.1| 163|Homo sapiens RNA polymerase II elongat... 82 5e-16 U37558-1|AAA79202.1| 150|Homo sapiens OCP2 protein. 82 5e-16 U33760-1|AAC50241.1| 163|Homo sapiens cyclin A/CDK2-associated ... 82 5e-16 BC065730-1|AAH65730.1| 163|Homo sapiens S-phase kinase-associat... 82 5e-16 BC020798-1|AAH20798.1| 163|Homo sapiens S-phase kinase-associat... 82 5e-16 BC009839-1|AAH09839.1| 163|Homo sapiens S-phase kinase-associat... 82 5e-16 BC025673-1|AAH25673.1| 160|Homo sapiens S-phase kinase-associat... 58 6e-09 BC130418-1|AAI30419.1| 1153|Homo sapiens ARID4B protein protein. 28 9.0 BC009035-1|AAH09035.1| 293|Homo sapiens Similar to brain-specif... 28 9.0 AY220790-1|AAO63590.1| 1312|Homo sapiens SIN3A-associated protei... 28 9.0 AL391994-7|CAI13752.1| 1071|Homo sapiens AT rich interactive dom... 28 9.0 AL391994-6|CAI13751.1| 1226|Homo sapiens AT rich interactive dom... 28 9.0 AL391994-2|CAI13747.1| 1310|Homo sapiens AT rich interactive dom... 28 9.0 AL391994-1|CAI13746.1| 927|Homo sapiens AT rich interactive dom... 28 9.0 AL354919-7|CAM12879.1| 1500|Homo sapiens brain-specific angiogen... 28 9.0 AL354919-5|CAI16890.1| 1584|Homo sapiens brain-specific angiogen... 28 9.0 AL354919-3|CAM12875.1| 1554|Homo sapiens brain-specific angiogen... 28 9.0 AL354919-2|CAM12874.1| 1466|Homo sapiens brain-specific angiogen... 28 9.0 AL354919-1|CAM12876.1| 1499|Homo sapiens brain-specific angiogen... 28 9.0 AL133418-7|CAI22963.1| 1071|Homo sapiens AT rich interactive dom... 28 9.0 AL133418-6|CAI22962.1| 1226|Homo sapiens AT rich interactive dom... 28 9.0 AL133418-5|CAI22961.1| 1310|Homo sapiens AT rich interactive dom... 28 9.0 AL133418-1|CAI22958.1| 927|Homo sapiens AT rich interactive dom... 28 9.0 AF227899-1|AAF36964.1| 873|Homo sapiens breast carcinoma-associ... 28 9.0 AF214114-1|AAF28341.2| 1226|Homo sapiens retinoblastoma-binding ... 28 9.0 AF208045-1|AAF23433.3| 1213|Homo sapiens breast cancer-associate... 28 9.0 AF083249-1|AAD41239.1| 748|Homo sapiens Rb binding protein homo... 28 9.0 AB210032-1|BAE06114.1| 1325|Homo sapiens ARID4B variant protein ... 28 9.0 AB065648-1|BAC05874.1| 1573|Homo sapiens seven transmembrane hel... 28 9.0 AB030181-1|BAA89794.1| 803|Homo sapiens RBP1-like protein protein. 28 9.0 AB005298-1|BAA25362.1| 1572|Homo sapiens BAI 2 protein. 28 9.0 >Z47087-1|CAA87392.1| 163|Homo sapiens RNA polymerase II elongation factor-like protein protein. Length = 163 Score = 81.8 bits (193), Expect = 5e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 11 ANMIKGKTPEEIRKTFNIKNDFTAAEEDQVRKENEWCEEK 130 ANMIKGKTPEEIRKTFNIKNDFT EE QVRKEN+WCEEK Sbjct: 124 ANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163 >U37558-1|AAA79202.1| 150|Homo sapiens OCP2 protein. Length = 150 Score = 81.8 bits (193), Expect = 5e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 11 ANMIKGKTPEEIRKTFNIKNDFTAAEEDQVRKENEWCEEK 130 ANMIKGKTPEEIRKTFNIKNDFT EE QVRKEN+WCEEK Sbjct: 111 ANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 150 >U33760-1|AAC50241.1| 163|Homo sapiens cyclin A/CDK2-associated p19 protein. Length = 163 Score = 81.8 bits (193), Expect = 5e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 11 ANMIKGKTPEEIRKTFNIKNDFTAAEEDQVRKENEWCEEK 130 ANMIKGKTPEEIRKTFNIKNDFT EE QVRKEN+WCEEK Sbjct: 124 ANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163 >BC065730-1|AAH65730.1| 163|Homo sapiens S-phase kinase-associated protein 1A (p19A) protein. Length = 163 Score = 81.8 bits (193), Expect = 5e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 11 ANMIKGKTPEEIRKTFNIKNDFTAAEEDQVRKENEWCEEK 130 ANMIKGKTPEEIRKTFNIKNDFT EE QVRKEN+WCEEK Sbjct: 124 ANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163 >BC020798-1|AAH20798.1| 163|Homo sapiens S-phase kinase-associated protein 1A (p19A) protein. Length = 163 Score = 81.8 bits (193), Expect = 5e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 11 ANMIKGKTPEEIRKTFNIKNDFTAAEEDQVRKENEWCEEK 130 ANMIKGKTPEEIRKTFNIKNDFT EE QVRKEN+WCEEK Sbjct: 124 ANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163 >BC009839-1|AAH09839.1| 163|Homo sapiens S-phase kinase-associated protein 1A (p19A) protein. Length = 163 Score = 81.8 bits (193), Expect = 5e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 11 ANMIKGKTPEEIRKTFNIKNDFTAAEEDQVRKENEWCEEK 130 ANMIKGKTPEEIRKTFNIKNDFT EE QVRKEN+WCEEK Sbjct: 124 ANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK 163 >BC025673-1|AAH25673.1| 160|Homo sapiens S-phase kinase-associated protein 1A (p19A) protein. Length = 160 Score = 58.4 bits (135), Expect = 6e-09 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 11 ANMIKGKTPEEIRKTFNIKNDFTAAEEDQV 100 ANMIKGKTPEEIRKTFNIKNDFT EE QV Sbjct: 124 ANMIKGKTPEEIRKTFNIKNDFTEEEEAQV 153 >BC130418-1|AAI30419.1| 1153|Homo sapiens ARID4B protein protein. Length = 1153 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 777 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 805 >BC009035-1|AAH09035.1| 293|Homo sapiens Similar to brain-specific angiogenesis inhibitor 2 protein. Length = 293 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 6 VPQT*SKERLLKKSVKRSTLRMISLLQKKIRF 101 VP+ + R + ++V ST++M SL +KK+R+ Sbjct: 143 VPEPGERSRTMPRTVPGSTMKMGSLERKKLRY 174 >AY220790-1|AAO63590.1| 1312|Homo sapiens SIN3A-associated protein 180 protein. Length = 1312 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 777 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 805 >AL391994-7|CAI13752.1| 1071|Homo sapiens AT rich interactive domain 4B (RBP1-like) protein. Length = 1071 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 691 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 719 >AL391994-6|CAI13751.1| 1226|Homo sapiens AT rich interactive domain 4B (RBP1-like) protein. Length = 1226 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 691 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 719 >AL391994-2|CAI13747.1| 1310|Homo sapiens AT rich interactive domain 4B (RBP1-like) protein. Length = 1310 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 775 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 803 >AL391994-1|CAI13746.1| 927|Homo sapiens AT rich interactive domain 4B (RBP1-like) protein. Length = 927 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 582 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 610 >AL354919-7|CAM12879.1| 1500|Homo sapiens brain-specific angiogenesis inhibitor 2 protein. Length = 1500 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 6 VPQT*SKERLLKKSVKRSTLRMISLLQKKIRF 101 VP+ + R + ++V ST++M SL +KK+R+ Sbjct: 1350 VPEPGERSRTMPRTVPGSTMKMGSLERKKLRY 1381 >AL354919-5|CAI16890.1| 1584|Homo sapiens brain-specific angiogenesis inhibitor 2 protein. Length = 1584 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 6 VPQT*SKERLLKKSVKRSTLRMISLLQKKIRF 101 VP+ + R + ++V ST++M SL +KK+R+ Sbjct: 1435 VPEPGERSRTMPRTVPGSTMKMGSLERKKLRY 1466 >AL354919-3|CAM12875.1| 1554|Homo sapiens brain-specific angiogenesis inhibitor 2 protein. Length = 1554 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 6 VPQT*SKERLLKKSVKRSTLRMISLLQKKIRF 101 VP+ + R + ++V ST++M SL +KK+R+ Sbjct: 1423 VPEPGERSRTMPRTVPGSTMKMGSLERKKLRY 1454 >AL354919-2|CAM12874.1| 1466|Homo sapiens brain-specific angiogenesis inhibitor 2 protein. Length = 1466 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 6 VPQT*SKERLLKKSVKRSTLRMISLLQKKIRF 101 VP+ + R + ++V ST++M SL +KK+R+ Sbjct: 1335 VPEPGERSRTMPRTVPGSTMKMGSLERKKLRY 1366 >AL354919-1|CAM12876.1| 1499|Homo sapiens brain-specific angiogenesis inhibitor 2 protein. Length = 1499 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 6 VPQT*SKERLLKKSVKRSTLRMISLLQKKIRF 101 VP+ + R + ++V ST++M SL +KK+R+ Sbjct: 1368 VPEPGERSRTMPRTVPGSTMKMGSLERKKLRY 1399 >AL133418-7|CAI22963.1| 1071|Homo sapiens AT rich interactive domain 4B (RBP1-like) protein. Length = 1071 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 691 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 719 >AL133418-6|CAI22962.1| 1226|Homo sapiens AT rich interactive domain 4B (RBP1-like) protein. Length = 1226 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 691 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 719 >AL133418-5|CAI22961.1| 1310|Homo sapiens AT rich interactive domain 4B (RBP1-like) protein. Length = 1310 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 775 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 803 >AL133418-1|CAI22958.1| 927|Homo sapiens AT rich interactive domain 4B (RBP1-like) protein. Length = 927 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 582 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 610 >AF227899-1|AAF36964.1| 873|Homo sapiens breast carcinoma-associated antigen isoform I protein. Length = 873 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 338 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 366 >AF214114-1|AAF28341.2| 1226|Homo sapiens retinoblastoma-binding protein 1-like 1 protein. Length = 1226 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 691 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 719 >AF208045-1|AAF23433.3| 1213|Homo sapiens breast cancer-associated antigen BRCAA1 protein. Length = 1213 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 696 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 724 >AF083249-1|AAD41239.1| 748|Homo sapiens Rb binding protein homolog protein. Length = 748 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 231 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 259 >AB210032-1|BAE06114.1| 1325|Homo sapiens ARID4B variant protein protein. Length = 1325 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 790 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 818 >AB065648-1|BAC05874.1| 1573|Homo sapiens seven transmembrane helix receptor protein. Length = 1573 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 6 VPQT*SKERLLKKSVKRSTLRMISLLQKKIRF 101 VP+ + R + ++V ST++M SL +KK+R+ Sbjct: 1423 VPEPGERSRTMPRTVPGSTMKMGSLERKKLRY 1454 >AB030181-1|BAA89794.1| 803|Homo sapiens RBP1-like protein protein. Length = 803 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 29 KTPEEIRKTFNIKNDFTAAEEDQVRKENE 115 K+PE +RK + ++ T EED+V K+ + Sbjct: 458 KSPERLRKDIEVLSEDTDYEEDEVTKKRK 486 >AB005298-1|BAA25362.1| 1572|Homo sapiens BAI 2 protein. Length = 1572 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 6 VPQT*SKERLLKKSVKRSTLRMISLLQKKIRF 101 VP+ + R + ++V ST++M SL +KK+R+ Sbjct: 1423 VPEPGERSRTMPRTVPGSTMKMGSLERKKLRY 1454 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,013,732 Number of Sequences: 237096 Number of extensions: 766946 Number of successful extensions: 1417 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1417 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 1968306988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -