BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0705 (424 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.15 |||WD repeat protein, human WRDR85 family|Schizosaccha... 25 6.4 SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual 24 8.5 SPBC1604.16c |||RNA-binding protein, G-patch type |Schizosacchar... 24 8.5 >SPCC18.15 |||WD repeat protein, human WRDR85 family|Schizosaccharomyces pombe|chr 3|||Manual Length = 310 Score = 24.6 bits (51), Expect = 6.4 Identities = 5/14 (35%), Positives = 12/14 (85%) Frame = +2 Query: 221 VRSKWRVHEFEIWS 262 +++KW+ H++E W+ Sbjct: 133 IKNKWKEHDYEAWT 146 >SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual Length = 484 Score = 24.2 bits (50), Expect = 8.5 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = -2 Query: 312 KTESFIRSVTTRHIISVLHISNSWTRHLLLTYLMRRLDVTILGDVPSIMFTGVI 151 KT FI S ++ + ++ W R LL LDVT L V + F I Sbjct: 20 KTADFIESKSSSSSSLEVRLAGGWVRDKLLGLSSDDLDVT-LNKVTGVDFANSI 72 >SPBC1604.16c |||RNA-binding protein, G-patch type |Schizosaccharomyces pombe|chr 2|||Manual Length = 199 Score = 24.2 bits (50), Expect = 8.5 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 318 HTKTESFIRSVTTRHIISVLHISNSWTRHLL 226 ++K + +S+T H++S HISN + HLL Sbjct: 82 NSKKINHFKSMT--HLLSSQHISNKFQPHLL 110 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,390,749 Number of Sequences: 5004 Number of extensions: 24143 Number of successful extensions: 62 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 150383836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -