BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0705 (424 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.8 SB_6324| Best HMM Match : MCM (HMM E-Value=0) 27 4.8 SB_24436| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 >SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2362 Score = 28.3 bits (60), Expect = 2.8 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 225 LTYLMRRLDVTILGDVPSIMFTGVILYP 142 L ++R+ DVT+ G+ P I F +LYP Sbjct: 555 LLLILRKNDVTLKGERPFIEFLDSVLYP 582 >SB_6324| Best HMM Match : MCM (HMM E-Value=0) Length = 1592 Score = 27.5 bits (58), Expect = 4.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 176 GTSPKIVTSRRRIKYVRSKWRVHEF 250 G+ K+V +R YVR +W+ H+F Sbjct: 1336 GSRFKVVRIQRNDPYVRGRWQCHDF 1360 >SB_24436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 27.1 bits (57), Expect = 6.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 115 IIKVHSTILGFFCLVWVSLAPIDRTLVLNVWFI 17 ++ V+ T L +C VW+ + L + WFI Sbjct: 29 VVIVYRTALAVYCFVWLVFSGFSTMLGGDTWFI 61 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,307,091 Number of Sequences: 59808 Number of extensions: 165817 Number of successful extensions: 313 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -