BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0699 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.0 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 25 2.0 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 25 2.6 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 6.0 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 7.9 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.0 bits (52), Expect = 2.0 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +2 Query: 413 LHHKETIYSGMVEVLIYVFDVESREMEKDMHYY 511 LHH + +++ + + +VE +E+EK H + Sbjct: 425 LHHHQQVHNQQRILYCFCRNVECKELEKSYHTF 457 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 25.0 bits (52), Expect = 2.0 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +2 Query: 266 LSYSPII*QGIQDASEQQLTLN--IHMSVSSVIWFSTYG 376 LSY+ +I Q I AS+ +LTL+ V +V +F G Sbjct: 119 LSYADLITQAISSASDSRLTLSQIYEWMVQNVPYFKDKG 157 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 24.6 bits (51), Expect = 2.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 392 KLSWKTILHHKETIYSGMVEVL 457 K WKT L+HKE + + +L Sbjct: 221 KKGWKTTLYHKELFAAALDRIL 242 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.4 bits (48), Expect = 6.0 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = +1 Query: 211 KKKVLLMGKSGSGKTSM 261 K+ LL+GK+GSGK+++ Sbjct: 107 KRANLLVGKNGSGKSAI 123 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +2 Query: 359 WFSTYGIVVVRKLSWKTILHH 421 W Y ++ R L+W T L H Sbjct: 394 WRQMYSMIHFRNLAWGTPLRH 414 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,990 Number of Sequences: 2352 Number of extensions: 14010 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -