BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0687 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 28 0.092 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 23 3.4 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 27.9 bits (59), Expect = 0.092 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 218 ANSGLVQICKMAQVYPXPAPEGCTSAXSESAPSDQPXYPDTG 343 A GL + ++ VYP C E++ SD P +P G Sbjct: 178 ARHGLETLSQLMDVYPNNDGTKCLVVTDEASISDAPFFPHRG 219 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 467 TKXAQHHPIRHKHXHQA 517 TK HH I+ +H HQ+ Sbjct: 101 TKFNPHHEIKLQHLHQS 117 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,264 Number of Sequences: 336 Number of extensions: 2646 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -