BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0687 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A3.04 |rpl8||60S ribosomal protein L7a |Schizosaccharomyce... 121 1e-28 SPBC2A9.07c |||zf-PARP-type zinc finger protein|Schizosaccharomy... 26 5.0 SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|S... 26 6.6 >SPBC29A3.04 |rpl8||60S ribosomal protein L7a |Schizosaccharomyces pombe|chr 2|||Manual Length = 259 Score = 121 bits (291), Expect = 1e-28 Identities = 63/135 (46%), Positives = 79/135 (58%), Gaps = 1/135 (0%) Frame = +3 Query: 165 NPLFEXXPKNFAIGQGIQPTRDLSRFVRWPKYIRIQRQKAVLQRXLKVPPPINXFTQTLD 344 NPLF P++F IGQ IQP RDLSRFV+WP+YIR+QR++ +L LKVPP I F +TLD Sbjct: 24 NPLFVSRPRSFGIGQDIQPKRDLSRFVKWPEYIRLQRRRKILNLRLKVPPAIAQFQKTLD 83 Query: 345 KTTAKGLFKILXKYRPET-XXXXXXXXXXXXXXXXXXXXXXXXXXXNTIRSGTNTXTKLV 521 K TA +FK+L KYRPET ++ G N L+ Sbjct: 84 KNTATQVFKLLNKYRPETAAEKKQRLVAEAEAVANGKSAQDVSKKPYNVKYGLNHVVALI 143 Query: 522 EKKKAQLVVIAHDVD 566 E KKA+LV+IA DVD Sbjct: 144 EAKKAKLVLIASDVD 158 Score = 30.3 bits (65), Expect = 0.31 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 568 PIELVLFLPALCRXXG 615 PIELV+FLPALC+ G Sbjct: 159 PIELVVFLPALCKKMG 174 >SPBC2A9.07c |||zf-PARP-type zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 274 Score = 26.2 bits (55), Expect = 5.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 614 PXXRHNAGRKRTSSMGINIMSDDHK 540 P +H A RKR+ S I I+ DD + Sbjct: 170 PNKKHKAERKRSPSPKIEILEDDEE 194 >SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2337 Score = 25.8 bits (54), Expect = 6.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 507 LCLCRIGWC 481 LCLC IGWC Sbjct: 2326 LCLCYIGWC 2334 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,461,391 Number of Sequences: 5004 Number of extensions: 40182 Number of successful extensions: 91 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -